Please Accept our Privacy Policy
Datasmart/Duncan Security LLC
Houston, TX • (25.8 miles) • Full Time • 9/15/2026
Job Summary: This position is responsible for the installation and activation of monitored security systems through the Company. Is responsible for trouble shooting and repairing these systems when needed. It also helps with other low voltage/AV/network installations of products purchased by the customer.Responsibilities:Basic alarm panel programming.· Basic networking knowledge from router set up, terminating all fittings (Cat 5, Cat 6, R66, BNC, etc.) and inserts.· Speaker installs and volume controls.· Able to find cables or tone cables in walls.· Assists with television hangs.· Able to install WI-FI packages.· Activations for Alarm.com and Total Connect.· Able to install cameras and DVRs.· Knowledge of security panels.· Television hangs without help.· Able to hook up audio/amps.· ProjeFirst Response Solution LLC
Houston, TX • (25.8 miles) • Full Time • 9/15/2026
First Response Solution - Security Officer (Commissioned/Non-Commissioned)Position Type: Part and Full TimePay Rate: starting pay at $12/hour (DOE)At First Response Solution, we are committed to delivering unparalleled security services rooted in integrity, professionalism, and real-world expertise. We are seeking dedicated, motivated Security Officers to join our team and help us protect our clients' assets and ensure the safety of their personnel.Responsibilities:Patrol and monitor assigned posts to prevent and detect security breaches.Enforce client-specific rules and regulations, as well as company policies and procedures.Conduct regular checks of assigned areas to ensure safety and security.Respond to alarms, emergencies, and other security incidents, providing assistance and maintainProTech Fire And Security
Houston, TX • (25.8 miles) • Full Time • 9/15/2026
The Senior Project Manager for Commercial Fire Alarm and Security Installs will oversee medium-sized project teams, typically consisting of 6-15 members, ensuring the successful delivery of installation projects for fire alarm and security systems. Reporting to Senior Management, this role requires frequent travel to job sites to maintain direct oversight and client engagement. The ideal candidate will combine strong project management skills with industry-specific knowledge to coordinate teams, manage budgets, and uphold safety and quality standards.ResponsibilitiesPlan and schedule project activities to ensure timely completionCoordinate and lead project teams to achieve objectivesMaintain effective communication with clients and stakeholdersManage project budgets and control costsEnsureFIRST CALL SECURITY INNOVATIONS LLC
Houston, TX 77032 • (14.6 miles) • Full Time • 9/11/2026
About the Role:First Call Security Innovations LLC is looking for a skilled Security Cable Installation Technician to join our growing team in Houston, TX. If you're passionate about hands-on technical work and want to play a key role in keeping businesses secure, this is the opportunity for you. Come build your career with a company that values craftsmanship, reliability, and cutting-edge security solutions.Responsibilities:Install, terminate, and test low-voltage security cabling including coax, Cat5e/Cat6, and fiber optic linesRun and route cables through walls, ceilings, conduit, and other structures in residential and commercial settingsMount and connect security cameras, access control panels, alarm systems, and related hardwareRead and interpret blueprints, wiring diagrams, and systLocke Protective Services
Houston, TX • (25.8 miles) • Full Time • 9/11/2026
HIRING NOW!!!We are seeking a Security Officers (Commissioned and Non-Commissioned) and Response Officers to become an integral part of our team. The selected individual will patrol and secure assigned premises as well as identify risks to staff and patrons.Qualifications:Must have reliable transportationMust have TX Driver's License & SS CardMust have working phoneMust be at least 21 years of ageMust have a clear criminal backgroundPay Rate: $18.00 Benefits include Weekly Pay, Holiday Pay, Direct Deposit, Company paid uniforms, Paid Vacations, 401K Plan, and Medical and Dental Plans. Officer of the Quarter AwardMust apply in person at: 1616 S. Voss, Houston, TX 77057, Suite #250 Monday-Friday 8:30 am to 3:30 pm.\nCompany DescriptionIn business since 1994, Locke Protective Services is theAMSYS Innovative Solutions LLC
Prairie View, TX • (33.1 miles) • Full Time • 9/11/2026
Fortinet Network Security EngineerWe are looking for a hands-on Fortinet expert with strong experience working with Fortinet network security solutions.The primary requirement for this role is deep, practical Fortinet experience. We are looking for someone who has worked extensively with Fortinet technologies and can independently configure, manage, troubleshoot, and support Fortinet environments.What we're looking for:Strong hands-on experience with Fortinet / FortiGateConfiguration, administration, and troubleshooting of Fortinet firewallsExperience with firewall policies, NAT, VPNs, security profiles, and related Fortinet security featuresExperience managing and troubleshooting Fortinet environments in productionFamiliarity with FortiManager and FortiAnalyzer is preferredAbility to indeGuardian Safe & Lock LLC
Tomball, TX • (11.4 miles) • Full Time • 9/10/2026
Security Technician (Locksmith / Access Control / CCTV / Structured Cabling)Guardian Safe & Lock LLC – Houston, TX (Tomball Area)Guardian Safe & Lock LLC is one of the fastest-growing locksmith and security companies in the Houston metropolitan area. We specialize in access control, CCTV, and physical security integration, and we are looking for a motivated Security Technician to grow with us.This is not just a job, this is a long-term career opportunity with a company that is expanding year over year and building a strong, high-performing team.In this role, you will be responsible for installing, maintaining, troubleshooting, and repairing a wide range of security systems and related infrastructure. You will travel to residential, commercial, and industrial job sites performing a varietyAll Nation Security Services, Inc.
Houston, TX • (25.8 miles) • Full Time • 9/5/2026
Join Our Security Team!Are you looking for a stable, rewarding job with growth opportunities? We’re hiring dedicated security professionals! Here’s what we offer:What We Offer:- Set schedules available – Day, swing, and overnight shifts based upon availability.- 90-Day Raise and Performance Bonuses– Start building your career and earning more, fast.- Growth Opportunities– We promote from within for those ready to take the next step!Requirements:- Must Pass a Drug Test – This is a non-negotiable requirement.- Experience & Knowledge – Prior security experience is a plus, but we’re willing to train the right candidates.- Credentials – You must possess:- A valid Texas ID or Driver’s License.- A valid Social Security Card.- A current Non-Commission Security Guard License (Certificates are not aQuality Security Services
Houston, TX 77001 • (32.9 miles) • Full Time • 9/3/2026
We are seeking Armed Security Officers to provide mobile escort services for client personnel as they travel to and from work locations and while performing sensitive on-site tasks. This is an on-call position that requires flexibility and professionalism. Officers do not handle or transport valuables the role is strictly focused on protecting people and ensuring a safe working environment.ResponsibilitiesEscort and safeguard client personnel during travel and onsite assignments.Provide a visible armed presence to deter threats while clients perform tasks.Remain alert to potential risks and respond appropriately to incidents.Maintain professional communication with dispatch, supervisors, and client personnel.Complete accurate daily activity and incident reports.Follow all company policies,Virtuo Group Corporation
Houston, TX • (25.8 miles) • Full Time • 9/2/2026
Are you passionate about protecting organizations from cyber threats and helping shape the future of cybersecurity? Virtuo Group is seeking a skilled and motivated Cybersecurity Analyst to join our award-winning team. In this role, you’ll monitor, detect, and respond to security incidents, while working alongside experts who are dedicated to keeping our clients’ systems secure. If you thrive in a fast-paced, dynamic environment and enjoy solving complex challenges, this is the opportunity to make a real impact.Workdays & Hours: MONDAY – FRIDAY 8:00 AM – 5:00 PM* *Subject to Change / Remote is Not an OptionDESCRIPTION OF DUTIES / ESSENTIAL FUNCTIONSDuties, functions and responsibilities of this position include:Responsible for communicating cyber risks and recommendations to mitigate risksIn Service Security LLC
Houston, TX • (25.8 miles) • Full Time • 8/21/2026
We are seeking a Commissioned Security Officerto become an integral part of our team. The selected individual will patrol and secure assigned premisesas well as identify risks to staff and patrons.Responsibilities:Monitor premises to prevent theft, violence, or infractions of rulesThoroughly examinedoors, windows, and gates to ensure proper function and securityWarnviolators of premise rules and regulationsApprehendor expelpersons engaging in suspicious or criminal actsReport anyfacility issues such as fire hazardsRequest emergency personnel for high risk situationsQualifications:Previous experience in security, law enforcement,or other related fieldsFamiliarity with security equipmentAbility to handle physical workloadStrong attention to detail\nCompany DescriptionIn Service Security LLCCParrish Security Group
Channelview, TX 77530 • (32.2 miles) • Full Time • 8/20/2026
Dispatcher- Must have verifiable experience in a security operations environment. Must demonstrate mastery of CCTV console operations. Must have a working knowledge of Lenel OnGuard software's System Administration Section. Must be able to type 40wpm.Actively hiring security officers to protect the facility’s assets, personnel, and operations from security threats. This includes patrolling the premises, controlling access, responding to incidents, and enforcing security protocols. You will also play a crucial role in maintaining a safe and secure environment by monitoring surveillance equipment, conducting inspections, and ensuring compliance with safety regulations.Responsibilities:Access Control - Monitoring and controlling the entry and exit of personnel, vehicles, and materials, prevenLantern Village Apartments
Houston, TX • (25.8 miles) • Full Time • 8/19/2026
One of the largest residential apartment communities in Southwest Houston is seeking a dependable, observant, and customer-service-oriented Unarmed Security Officer. In this role, you will maintain a safe, welcoming environment for residents and guests through active foot patrols, visitor logging, and clear daily communication.Key Responsibilities:Access Control & Visitor Logging: Greet residents and visitors, verify credentials, and maintain accurate visitor and vehicle logs at access points.Property Patrols: Perform routine, thorough foot patrols across property grounds, parking areas, and common amenities to deter unauthorized activity.Documentation & Reporting: Maintain detailed shift logs and draft clear, professional incident reports or daily correspondence.Resident Assistance & ServMAVERICK REIGN LLC
Spring, TX 77386 • (6.4 miles) • Full Time • 8/18/2026
We are seeking a Commissioned Security Officerto become an integral part of our team. The selected individual will patrol and secure assigned premisesas well as identify risks to staff and patrons.Responsibilities:Monitor premises to prevent theft, violence, or infractions of rulesThoroughly examinedoors, windows, and gates to ensure proper function and securityWarnviolators of premise rules and regulationsApprehendor expelpersons engaging in suspicious or criminal actsReport anyfacility issues such as fire hazards andleaking water pipesRequest emergency personnel for high risk situationsQualifications:Previous experience in security, law enforcement,or other related fieldsFamiliarity with security equipmentAbility to handle physical workloadStrong attention to detailVAM USA
Houston, TX 77073 • (11.3 miles) • Full Time • 9/13/2026
HSSE AdvisorMake An Impact With USThe HSSE Advisor will be a business representative for health, safety, security and environmental (HSSE) programs, ensuring compliance with Vallourec policies and standards, maintaining compliance with ISO Certification standards, and all local, state, and federal regulations. An HSSE Advisor is responsible for promoting a proactive HSSE culture and driving a continuous improvement-based HSSE management system. An HSSE Advisor will collaboration across business departments to align/standardize health, safety, security and environmental programs. An HSSE Advisor is responsible to support development of World Best in Class programs in HSSE Leadership, Management Systems and Culture to deliver on Vallourec’s ambitions for 2030 and beyond.Your Role at a GlanceWaveStrong, Inc.
Houston, TX • (25.8 miles) • Full Time • 9/12/2026
Exciting Security / Soc Analyst III, 6 months contract opportunity in Houston, TX.Requirements5 plus years experience in the security domain, Incident Response, threat monitoring, and handling incidents (incident triage and response)Determine detection requirements for data sources being on-boarded to the SIEM, and assessing the value of in place SIEM detection cases, in order to determine gaps and overlap in the overall detection scheme.Perform security monitoring and incident response of cyber security events for proper determination of being considered a cybersecurity event.Triage offenses for false positivesHands-on experience defining detection or protection schemes based on industry standards and frameworks.SIEM, Endpoint Detection and Response, Firewall/IPS/IDS, Proxy, Data Loss PrePure IT CUSO
Tomball, TX 77375 • (9.9 miles) • Full Time • 9/11/2026
About Us We’re a growing Managed Services Provider (MSP) dedicated to supporting credit unions with their IT and cybersecurity needs. Our mission is simple: keep our clients’ technology secure, reliable, and running smoothly so they can focus on serving their members. We value teamwork, curiosity, and innovation, and we believe that doing great work should also be fun. If you’re eager to build your cybersecurity career in a supportive, fast-growing environment, you’ll feel right at home here.The Position: The Security Analyst is an entry-level cybersecurity professional responsible for monitoring, analyzing, and supporting our client's organization’s security. This role focuses on operational security and works closely with outsourced Security Operations Centers (SOCs), internal InformatioFIRST SERVICE CREDIT UNION
Houston, TX • (25.8 miles) • Full Time • 9/11/2026
Role:As a Cybersecurity Analyst, you will protect the Credit Union's information assets, systems, and member data through proactive monitoring, risk management, incident response, security governance, and continuous improvement activities. The position supports cybersecurity operations, regulatory compliance, vendor risk management, and cyber resilience initiatives aligned with NIST Cybersecurity Framework (CSF), CIS Controls, FFIEC guidance, and NCUA expectations. The Cybersecurity Analyst partners with technology and business teams to integrate security into all business processes and technology solutionsEssential Functions & Responsibilities:Monitor and investigate security events, alerts, and anomalous activity. Analyze threats using SIEM, EDR, NGAV, and threat intelligence sources. PaState Fire
Houston, TX 77001 • (32.9 miles) • Full Time • 9/11/2026
Description: Join a company where your reliability and craftsmanship are valued. State Fire is seeking an experienced, licensed Fire Alarm Technician to join our growing team in the Houston, TX region. As a regional leader in fire protection, we specialize in the installation, service, and maintenance of fire alarm systems, alarm monitoring, special hazard suppression systems, fire sprinklers, security systems, and more.We’re looking for a dependable professional who takes pride in doing the job right, someone with strong technical ability, a solid work ethic, and a commitment to quality and safety. If you want to build a long-term career with a company that values expertise and reliability, we want to hear from you.What You’ll Do Install, inspect, service, and maintain a variety of fire aEvergreen Fire And Security
Houston, TX 77001 • (32.9 miles) • Full Time • 9/11/2026
Who We AreEvergreen Fire and Security (EFS) is a recognized leader in the life safety and security solutions industry. We are entrusted by the Federal Government and commercial customers to protect lives, critical infrastructure, and information by providing and maintaining technically advanced and innovative fire alarm, access control, intrusion detection, CCTV, mass notification, and other critical protection systems.The Key to Our SuccessOur success is largely due to the experience, skills, and expertise of the best and brightest employees in the industry. Due to growth, we are looking for additional qualified experts to join the Evergreen team. Think you have what it takes? Great! We welcome you to submit your qualifications for this great Evergreen Fire and Security career opportunityTRI SHIELD SECURITY & INVESTIGATIONS LLC
Houston, TX • (25.8 miles) • Full Time • 9/10/2026
SECURITY OFFICERS - NON AND COMMISSIONEDTri Shield Security & Investigations Currently has an opening for a Full time Commission Security Officers to serve in the Houston area and must have level lll card in hand.*******************************************************************************************************We are seeking Experienced Security Officers with a positive attitude, customer service experience, great work ethics, and those who can work alone as well as with others. The ideal Security Officer is safety focused, an effective communicator, detail oriented, and ready to serve and protect the public and our clients.Position Details:(Full-time Level 3 Commissioned)Candidates with Criminal Justice, military, police, and Commissioned security experience are encouraged to apply.SEPegasus Preserve Of Memorial City
Houston, TX 77024 • (27 miles) • Full Time • 9/10/2026
Do you have a passion to serve Seniors? More importantly, do you want to know that every day you are making a difference in a resident’s life in a senior living building? Then come join our team Human Resources Director!Great Place to Work Certified – come make it greater!! So many perks and programs!!Lead Security Guard/Partner Perks, Programs, and Benefits:Flexible Scheduling – In most cases, we can work our schedules to fit your schedule! (FT/PT)Same-Day pay options available (FT/PT)Competitive Benefits! Some highlights include: Medical (FT), Dental (FT), Vision (FT), 401K including matching (FT/PT), Employee Assistance (FT/PT) and much more!Up to 20 days per year of PTO (FT)Access to various Travel, Restaurant, and Retail Discounts through HR Partners (FT/PT)Unlimited employee referralAbsolutesf LLC- Absolute Security Force LLC
Houston, TX 77003 • (28.7 miles) • Full Time • 9/10/2026
Benefits/PerksCareer Advancement OpportunitiesCompetitive CompensationFlexible ScheduleJob Summary We are seeking a professional Security Guard to join our team. In this role, your primary responsibility will be to create a safe and secure environment. You will protect our premises, assets, and employees and prevent any illegal or inappropriate occurrences. The ideal candidate has experience with public safety and security and operates with a high degree of integrity at all times. ResponsibilitiesPatrol the premises and maintain a high level of visibilityMonitor entrances and exits to ensure only authorized personnel access the facilityRemove trespassers when necessaryMonitor surveillance camerasRespond to reports of suspicious activityReport on daily activities and any security incidentsQGoldfish Swim School - Houston Heights
Houston, TX 77008 • (24.8 miles) • Full Time • 9/10/2026
Benefits:Free uniformsOpportunity for advancementTraining & developmentFlexible scheduleSaving and changing lives, every single day. We have a mission to teach kids how to swim and be safer, in and around the water, while making their experience GOLDEN! Working for Goldfish Swim School will allow you to provide children and families with necessary life skills to combat the ever-growing drowning statistics. Whether you are in the pool leading instruction for our swimmers or warmly greeting our members in our tropical lobby as a front desk representative, you are making an impact. Perks and Benefits:Paid on-the-job trainingFlexible schedulingCulture driven companyEmployee recognition programsPrimary Responsibilities:Keep swimmers safe with lifeguard supervisionProvide any first aid necessaryUnited Service Company
Houston, TX 77002 • (28.1 miles) • Full Time • 9/9/2026
Hotel Security Officer-FT United Security Services, Inc., a national security company, is seeking a professional full-time overnight Security Officer for an upscale hotel in the Downtown Houston area.Security Officer Position Requirements:At least 2 years of public safety or private security experience.Have excellent customer service skills and sound judgement.Schedule adherence and punctuality.Must be proficient with interacting, communicating and working jointly with a hotel staff.Must possess, or can acquire by time of employment, a Level II noncommissioned Texas Security Officer license.Must have the availability and flexible to work any day, including weekends and holidays, and any work shift based on the operational needs of the hotel.Must be able to climb stairs, stand, walk for lonExecutive Security Integrators & Fi
Channelview, TX 77530 • (32.2 miles) • Full Time • 9/9/2026
Benefits:401(k)401(k) matchingCompetitive salaryDental insuranceFree uniformsHealth insuranceOpportunity for advancementPaid time offTraining & developmentVision insurancePosition Summary: The standard function of the position is to build, program, deploy, and service our Mobile Security Trailers (MSTs). The position requires that the candidate is able to adjust to a fast-paced market where last-minute movements happen often. The candidate will need to be able to work with minimal supervision and provide great customer service. Duties And ResponsibilitiesInstall and service CCTV, batteries, solar panels, and solar controls.Maintain and service small engine gas powered generators.Must have a strong work ethic and ability to work well with other team members.Provides reliable, high quality cThompson Safety, LLC
Houston, TX 77066 • (14.3 miles) • Full Time • 9/9/2026
Job Summary:The Fire Alarm Technicianis responsible forthe installation, testing, inspection, service, and repair of fire alarm systems. Respond to emergency and maintenance calls and troubleshoot/replace faulty devices to restore alarm panels to “normal condition”.Complete inspection and service reports.Supervisory Responsibilities:NoneEssential Job Functions:Traveltocustomerlocationstoperforminstallation,service,andupgradesoffirealarmsystems.Respondtoemergencysituationsduringandafterbusinesshourstoresolvesafetyconcerns.PerformAnnualandSemi-annualinspectionofLifeSafetySystems.Write and provide inspection/service reports on tested equipment and devices.Indicate any deficiencies or corrections that need tobemade.TroubleshootanddiagnosefaultsormalfunctionsinfirealarmsystemsandtakeappropriatePreferred Technologies, LLC
Houston, TX 77093 • (21.2 miles) • Full Time • 9/9/2026
Why Pref-Tech?Voted "Top Workplaces" by Houston Chronicle and Austin American Statesman, 2 years in a row! We aim to make “family” a core reason we attract incredible people, retain them, and collectively deliver unequaled quality and service to customers. If your heart and mind are pushing you to join a team who deeply desires to be the best in the world, has a long-game approach to business, prides itself on doing exceptional work, celebrates service to others, and is willing to invest in you, you should consider Pref-Tech.Position Overview: This role is in Corpus Christi for an O&G facility. The Security Technician 2 at Pref-Tech will be responsible for installing access control, IP-based and analog video management systems, intrusion, and auto-gate equipment. Scope of duties include, bDigi Security Systems
Houston, TX • (25.8 miles) • Full Time • 9/9/2026
Digi Security Systems is an industry leader in the design, installation and support of custom video surveillance, electronic access control, and intrusion detection solutions for public and private partners. We've built our reputation on innovation and reliable service, and we're known as the industry's experts.Position OverviewDigi Security Systems is seeking an experienced low voltage Project Manager to oversee the planning and execution of high-level commercial security systems projects. A PMP certification (or equivalent project management certification) required.This role involves managing teams responsible for installation, service, troubleshooting, and programming of systems including video surveillance, electronic access control, and intrusion detection. Preference will be given toPower Plus
Houston, TX 77041 • (22 miles) • Full Time • 9/8/2026
Are you a lead-generating, prospecting, relationship-building, sales machine? Do you love the challenge of discovering potential clients, reaching out to them, and maintaining relationships? If so, we should talk.We arePower Plus!A multi-industry leader in providing power when you need it, where you need it through intelligent and efficient power solutions. We work with Fortune 100 companies across the country such as Amazon, Wal-Mart, Costco, and more. We’ve built a more than 35-year reputation for excellence through our commitment to developing our people, providing exceptional, relationship-based customer service, and giving back to the community. Our biggest differentiator is the quality of our people, and the working environment we create for them, which really has to be seen to be beNational Collaboration Security, LLC
Houston, TX 77021 • (32.2 miles) • Full Time • 9/8/2026
Benefits:401(k)Employee discountsBenefits/PerksCareer Advancement OpportunitiesCompetitive CompensationFlexible ScheduleJob Summary We are seeking a professional Security Guard to join our team. In this role, your primary responsibility will be to create a safe and secure environment. You will protect our premises, assets, and employees and prevent any illegal or inappropriate occurrences. The ideal candidate has experience with public safety and security and operates with a high degree of integrity at all times. ResponsibilitiesPatrol the premises and maintain a high level of visibilityMonitor entrances and exits to ensure only authorized personnel access the facilityRemove trespassers when necessaryMonitor surveillance camerasRespond to reports of suspicious activityReport on daily activEnchanted Rock Management LLC
Houston, TX 77002 • (28.1 miles) • Full Time • 9/8/2026
Description: We are ERock!ERock is a leader and innovator in distributed energy. ERock has responded to long-term trends in electricity by becoming the first smart-grid supplier to US energy consumers. The company installs, operates, and integrates its highly flexible, low-cost, and quick-response distributed generation to increase reliability and stability, reduce costs and decrease carbon footprint.At ERock, our backup generators ensure that customers will never be without power, allowing their business to operate normally when there is an outage in the area. Our innovative approach provides customers with highly reliable, ultra-clean backup generation at a fraction of the cost of traditional backup solutions. We seek those who share our commitment to customer service, innovation, and inQuanex
Houston, TX 77024 • (27 miles) • Full Time • 9/5/2026
Quanex is looking for aCybersecurity Manager in Houston, TX or Akron, OH.The Cybersecurity Manager will be responsible for oversight, monitoring, and alerting all aspects of the Quanex cybersecurity environment. This position will have direct reports and will be responsible for the cybersecurity program of the business.We Offer You!Competitive Salary401K Match w/ 2-year vesting periodBonus PotentialMedical, Dental & Vision PlansPaid Time Off & HolidaysVarious Work SchedulesTuition AssistanceWellness/Fitness ResourcesTraining/DevelopmentEmployee Stock Purchase PlanDynamic Culture & People - just to name a few!What’s attractive about the Cybersecurity Manager position?Lead and strengthen Quanex’s enterprise cybersecurity program, helping protect critical systems, data, and global operations.SwimJim Texas
Houston, TX 77042 • (29.6 miles) • Full Time • 9/5/2026
SwimJim Texas is a year-round, indoor, heated facility looking to interview future SwimJim super hero lifeguards and swim coaches! We are looking for individuals who can add to our already fun and dynamic team. We are a team consisting of individuals who genuinely enjoy working with one another and have great work ethic and believe in making every day, a positive one!Our mission is to help prevent drowning in a Happier, Healthier and Safer method.We are looking for excited individuals who understand the importance of water safety and keeping swimmers safe. We are looking for individuals who take pride in their duties and responsibilities as lifeguards and swim instructors. All swim instructor training is done in-house. Give us the opportunity to train you with the tools necessary to becomeSENTRYSIX International
Houston, TX 77015 • (31.5 miles) • Full Time • 9/5/2026
*** THIS ANNOUNCEMENT MAY SERVE AS A CONTINUOUS ANNOUNCEMENT FOR ADDITIONAL VACANCIES FOR BOTH DAY AND NIGHT SHIFTS ***OverviewWe are seeking an Armed Security Specialist III to become an integral part of our team. In this position, you will be tasked to provide physical security, physical security inspections and entry access control at designated locations.A position with SENTRYSIX International is more than just a job, it’s the start of a great career. Joining the SENTRYSIX team means that you are joining an operational support and threat management provider to government and commercial clients worldwide. Because of this, we search for individuals of the highest caliber and experience.Veteran owned & operated company – Are you a Veteran? – We want to hear from you! APPLY TODAY!ResponsibCharlie Mike Protective Services
Houston, TX 77056 • (28.3 miles) • Full Time • 9/4/2026
Unarmed Security Officer$25/hour | Childress, TX | Housing, Transportation & Meals Provided | W-2 Employment | Growth Into Armed & Executive Protection | Full-Time OpportunitiesThis position is assigned toChildress, Texas. Transportation, lodging, and meals are provided. Team members may stay on-site for extended periods depending on project schedules. Candidates from Dallas, Amarillo, and surrounding areas are encouraged to apply.You represent the client, the company, and the standard every time you step on site.You stay alert, communicate professionally, handle pressure without losing composure, and take ownership without needing someone to constantly manage you.This is not a “sit around and collect a check” security position.At* Charlie Mike Protection,* we are building a team of dependZona Facta Collective
Houston, TX 77001 • (32.9 miles) • Full Time • 9/4/2026
Zona Facta CollectivePosition: Level III ATM Protection AgentLocation: Houston, TX (Hybrid)Department: OperationsCompensation: $20.00/hour | Weekly Direct DepositEmployment Type: 1099 Independent ContractorJob OverviewZona Facta Collective is currently seeking qualified Level III Armed Security Agents for multiple security contracts across Texas. We have an immediate need for our ATM Technician Security Contract in the Greater Houston area. Agents will be responsible for escorting ATM technicians to ensure they can perform their tasks safely and without disruption.Key ResponsibilitiesEscort ATM technicians to and from job sites across the Greater Houston area.Ensure the safety of technicians during all assigned shifts.Remain on standby, ready to deploy at the start of each scheduled shift.J Holdings
Spring, TX 77388 • (6.9 miles) • Full Time • 9/4/2026
NON-COMMISSIONED Level 2 Security Guard Some alternating exterior foot patrols at some locations. Some locations require scans as part of the patrol. Must maintain communications with dispatch during shift. Prior security, military or LE experience a plus - an excellent opportunity for retirees. Required gear (must bring to interview): - Must have current security license or at least 1 year of security experience. Required: The experience required for these positions includes, but is not limited to: - Must be professional in appearance, skillset, and attitude. - Must be at least 21 years of age. - Must have reliable and dependable transportation. - Must have a smartphone. - MUST BE ABLE TO START IMMEDIATELY!!! - All employees must be able to pass a criminal background check, reference/prevTier One Holdings, LLC
Houston, TX • (25.8 miles) • Full Time • 9/4/2026
Armed Security Officer Houston, TX (North Cypress Area)Protect. Mentor. Lead.Serve with Purpose.Houston, TexasAt Tier One, we believe every person deserves to feel safe where they work, receive medical care, worship, or do business. As an Armed Security Officer, you'll be more than a uniform the calm professional who brings confidence during uncertainty, the trusted presence people rely on, and the first line of defense when safety matters most.If you've worn a badge, served in the military, worked in security, or simply feel called to protect others, you already understand that real security is about earning trust not just carrying a firearm.About the AssignmentThis position supports a healthcare and community-safety environment at a major medical campus in the Houston area. Officers assiSolaris Oilfield Infrastructure, LLC
Houston, TX 77024 • (27 miles) • Full Time • 9/4/2026
Company Description About Solaris Energy Infrastructure Solaris Energy Infrastructure, Inc. (NYSE:SEI) provides scalable equipment-based solutions for use in distributed power generation as well as the management of raw materials used in the completion of oil and natural gas wells. Headquartered in Houston, Texas, Solaris serves multiple U.S. end markets, including energy, data centers, and other commercial and industrial sectors.Job Description About the OpportunitySolaris is building out networked power generation and distribution assets across multiple customer sites. Site networks reach down to turbine and balance-of-plant equipment, SCADA runs on Ignition, and protection and control includes SEL devices connected over SEL software-defined networking.This environment is being designedMetroNational
Houston, TX 77024 • (27 miles) • Full Time • 9/4/2026
Description:MUST be able to WORK Weekends / $18.60hr / MUST have valid TDLEverything we do at MetroNational comes back to our purpose: To Build Better Lives. It’s our North Star and the reason we do the work we do. As a MetroNational Bike Patrol Officer, you build better lives by forming bonds with our guests, tenants, and residents, developing relationships with them, and ensuring a safe environment on our beautiful campus in Memorial City.The Security Ambassador III - Bike Patrol, is responsible for securing designated areas in and around Memorial City Mall, conducting bike patrols. We believe in providing exceptional service every day and ask that you go above and beyond to make service a priority in your safety role. This position does require some scheduling flexibility as we provide