Please Accept our Privacy Policy
WaveStrong, Inc.
Houston, TX • (24.7 miles) • Full Time • 9/15/2026
Exciting Security / Soc Analyst III, 6 months contract opportunity in Houston, TX.Requirements5 plus years experience in the security domain, Incident Response, threat monitoring, and handling incidents (incident triage and response)Determine detection requirements for data sources being on-boarded to the SIEM, and assessing the value of in place SIEM detection cases, in order to determine gaps and overlap in the overall detection scheme.Perform security monitoring and incident response of cyber security events for proper determination of being considered a cybersecurity event.Triage offenses for false positivesHands-on experience defining detection or protection schemes based on industry standards and frameworks.SIEM, Endpoint Detection and Response, Firewall/IPS/IDS, Proxy, Data Loss PreThe Forum At Memorial Woods
Houston, TX • (24.7 miles) • Full Time • 9/15/2026
**Job Title: PRN Security Officer - Independent & Assisted Living Facility****Job Description:**We are seeking a dedicated and professional PRN Security Officer to join our team at our Independent and Assisted Living Facility. This position requires a reliable individual who is committed to maintaining the safety and security of our residents and staff, and who can work on an as-needed basis to support our facility’s operations.**Key Responsibilities:**- Monitor and patrol assigned areas to provide a safe and secure environment for residents, staff, and visitors. - Respond swiftly to emergency situations, ensuring the appropriate procedures are followed to maintain safety. - Report any suspicious activities, safety hazards, or other security concerns to management immediately. - Operate suMetroNational
Houston, TX 77024 • (25.4 miles) • Full Time • 9/15/2026
Description: ***MUST HAVE a VAID TEXAS DRIVERS LICENSE with NO RESTRICTIONS***MUST BE ABLE TO WORK ALL SHIFTS as ASSIGNED***Everything we do at MetroNational comes back to our purpose: To Build Better Lives. It’s our North Star and the reason we do the work we do. As a MetroNational Security Ambassador I, you build better lives by forming bonds with our guests, tenants, and residents, developing relationships with them, and ensuring a safe environment on our beautiful campus in Memorial City.As a Security Ambassador I, you may work in an office building, across our campus grounds/garages, a mall, or even a hospital. You may patrol on foot, cart, or bike, depending upon your interest and experience. We believe in providing exceptional service every day and ask that you go above and beyond tLucky Strike Entertainment
Houston, TX 77024 • (25.4 miles) • Full Time • 9/15/2026
OverviewYour next adventure starts here! At Lucky Strike Entertainment, great times and exciting opportunities go hand in hand. Join us as a Security Officer and become part of a vibrant atmosphere filled with dynamic experiences and endless possibilities. Start making your own luck today!Applicants must be at least 18 years of age to qualify for a position.WHAT OUR SECURITY OFFICERS DOSecurity Officers help to ensure our guests have a safe and enjoyable experience to remember. A SECURITY OFFICER’S DAY-TO-DAYGreet guests in a friendly and inviting mannerCheck guest identification when age restrictions are enforcedEnsure guests adhere to the venue’s safety policies and proceduresAssists with monitoring alcohol service security functions, including guest serving limitsDiffuses difficult guesS.A.F.E. MANAGEMENT
Houston, TX 77054 • (31.7 miles) • Full Time • 9/15/2026
Now Hiring Event Staff at NRG Park!Company DescriptionS.A.F.E. (Security, Athletic Facilities & Events) Management is specifically tailored guest services, security, crowd management and parking staffing company that specializes in sport facility, special event management and 24/7 facility security.Description:S.A.F.E. Management is currently hiring! Are you looking for a part-time job where you can make your own schedule? Do you thrive working in a fast-paced exciting atmosphere and enjoy sporting events and concerts? S.A.F.E. Management is currently hiring part-time Event Staff Team Members to work at - NRG Park in Houston, TX!Summary ? Part-Time Event StaffS.A.F.E. Management's team members enjoy working sporting events, concerts, and other events. We strive to be friendly & considerateFirst Response Solution LLC
Houston, TX • (24.7 miles) • Full Time • 9/15/2026
First Response Solution - Security Officer (Commissioned/Non-Commissioned)Position Type: Part and Full TimePay Rate: starting pay at $12/hour (DOE)At First Response Solution, we are committed to delivering unparalleled security services rooted in integrity, professionalism, and real-world expertise. We are seeking dedicated, motivated Security Officers to join our team and help us protect our clients' assets and ensure the safety of their personnel.Responsibilities:Patrol and monitor assigned posts to prevent and detect security breaches.Enforce client-specific rules and regulations, as well as company policies and procedures.Conduct regular checks of assigned areas to ensure safety and security.Respond to alarms, emergencies, and other security incidents, providing assistance and maintainDatasmart/Duncan Security LLC
Houston, TX • (24.7 miles) • Full Time • 9/15/2026
Job Summary: This position is responsible for the installation and activation of monitored security systems through the Company. Is responsible for trouble shooting and repairing these systems when needed. It also helps with other low voltage/AV/network installations of products purchased by the customer.Responsibilities:Basic alarm panel programming.· Basic networking knowledge from router set up, terminating all fittings (Cat 5, Cat 6, R66, BNC, etc.) and inserts.· Speaker installs and volume controls.· Able to find cables or tone cables in walls.· Assists with television hangs.· Able to install WI-FI packages.· Activations for Alarm.com and Total Connect.· Able to install cameras and DVRs.· Knowledge of security panels.· Television hangs without help.· Able to hook up audio/amps.· ProjeLocke Protective Services
Houston, TX • (24.7 miles) • Full Time • 9/11/2026
HIRING NOW!!!We are seeking a Security Officers (Commissioned and Non-Commissioned) and Response Officers to become an integral part of our team. The selected individual will patrol and secure assigned premises as well as identify risks to staff and patrons.Qualifications:Must have reliable transportationMust have TX Driver's License & SS CardMust have working phoneMust be at least 21 years of ageMust have a clear criminal backgroundPay Rate: $18.00 Benefits include Weekly Pay, Holiday Pay, Direct Deposit, Company paid uniforms, Paid Vacations, 401K Plan, and Medical and Dental Plans. Officer of the Quarter AwardMust apply in person at: 1616 S. Voss, Houston, TX 77057, Suite #250 Monday-Friday 8:30 am to 3:30 pm.\nCompany DescriptionIn business since 1994, Locke Protective Services is theAMSYS Innovative Solutions LLC
Prairie View, TX • (31.3 miles) • Full Time • 9/11/2026
Fortinet Network Security EngineerWe are looking for a hands-on Fortinet expert with strong experience working with Fortinet network security solutions.The primary requirement for this role is deep, practical Fortinet experience. We are looking for someone who has worked extensively with Fortinet technologies and can independently configure, manage, troubleshoot, and support Fortinet environments.What we're looking for:Strong hands-on experience with Fortinet / FortiGateConfiguration, administration, and troubleshooting of Fortinet firewallsExperience with firewall policies, NAT, VPNs, security profiles, and related Fortinet security featuresExperience managing and troubleshooting Fortinet environments in productionFamiliarity with FortiManager and FortiAnalyzer is preferredAbility to indeState Fire
Houston, TX 77001 • (32.3 miles) • Full Time • 9/11/2026
Description: Join a company where your reliability and craftsmanship are valued. State Fire is seeking an experienced, licensed Fire Alarm Technician to join our growing team in the Houston, TX region. As a regional leader in fire protection, we specialize in the installation, service, and maintenance of fire alarm systems, alarm monitoring, special hazard suppression systems, fire sprinklers, security systems, and more.We’re looking for a dependable professional who takes pride in doing the job right, someone with strong technical ability, a solid work ethic, and a commitment to quality and safety. If you want to build a long-term career with a company that values expertise and reliability, we want to hear from you.What You’ll Do Install, inspect, service, and maintain a variety of fire aTRI SHIELD SECURITY & INVESTIGATIONS LLC
Houston, TX • (24.7 miles) • Full Time • 9/10/2026
SECURITY OFFICERS - NON AND COMMISSIONEDTri Shield Security & Investigations Currently has an opening for a Full time Commission Security Officers to serve in the Houston area and must have level lll card in hand.*******************************************************************************************************We are seeking Experienced Security Officers with a positive attitude, customer service experience, great work ethics, and those who can work alone as well as with others. The ideal Security Officer is safety focused, an effective communicator, detail oriented, and ready to serve and protect the public and our clients.Position Details:(Full-time Level 3 Commissioned)Candidates with Criminal Justice, military, police, and Commissioned security experience are encouraged to apply.SEPegasus Preserve Of Memorial City
Houston, TX 77024 • (25.4 miles) • Full Time • 9/10/2026
Do you have a passion to serve Seniors? More importantly, do you want to know that every day you are making a difference in a resident’s life in a senior living building? Then come join our team Human Resources Director!Great Place to Work Certified – come make it greater!! So many perks and programs!!Lead Security Guard/Partner Perks, Programs, and Benefits:Flexible Scheduling – In most cases, we can work our schedules to fit your schedule! (FT/PT)Same-Day pay options available (FT/PT)Competitive Benefits! Some highlights include: Medical (FT), Dental (FT), Vision (FT), 401K including matching (FT/PT), Employee Assistance (FT/PT) and much more!Up to 20 days per year of PTO (FT)Access to various Travel, Restaurant, and Retail Discounts through HR Partners (FT/PT)Unlimited employee referralAbsolutesf LLC- Absolute Security Force LLC
Houston, TX 77003 • (27.7 miles) • Full Time • 9/10/2026
Benefits/PerksCareer Advancement OpportunitiesCompetitive CompensationFlexible ScheduleJob Summary We are seeking a professional Security Guard to join our team. In this role, your primary responsibility will be to create a safe and secure environment. You will protect our premises, assets, and employees and prevent any illegal or inappropriate occurrences. The ideal candidate has experience with public safety and security and operates with a high degree of integrity at all times. ResponsibilitiesPatrol the premises and maintain a high level of visibilityMonitor entrances and exits to ensure only authorized personnel access the facilityRemove trespassers when necessaryMonitor surveillance camerasRespond to reports of suspicious activityReport on daily activities and any security incidentsQGoldfish Swim School - Houston Heights
Houston, TX 77008 • (23.5 miles) • Full Time • 9/10/2026
Benefits:Free uniformsOpportunity for advancementTraining & developmentFlexible scheduleSaving and changing lives, every single day. We have a mission to teach kids how to swim and be safer, in and around the water, while making their experience GOLDEN! Working for Goldfish Swim School will allow you to provide children and families with necessary life skills to combat the ever-growing drowning statistics. Whether you are in the pool leading instruction for our swimmers or warmly greeting our members in our tropical lobby as a front desk representative, you are making an impact. Perks and Benefits:Paid on-the-job trainingFlexible schedulingCulture driven companyEmployee recognition programsPrimary Responsibilities:Keep swimmers safe with lifeguard supervisionProvide any first aid necessaryUnited Service Company
Houston, TX 77002 • (27 miles) • Full Time • 9/9/2026
Hotel Security Officer-FT United Security Services, Inc., a national security company, is seeking a professional full-time overnight Security Officer for an upscale hotel in the Downtown Houston area.Security Officer Position Requirements:At least 2 years of public safety or private security experience.Have excellent customer service skills and sound judgement.Schedule adherence and punctuality.Must be proficient with interacting, communicating and working jointly with a hotel staff.Must possess, or can acquire by time of employment, a Level II noncommissioned Texas Security Officer license.Must have the availability and flexible to work any day, including weekends and holidays, and any work shift based on the operational needs of the hotel.Must be able to climb stairs, stand, walk for lonExecutive Security Integrators & Fi
Channelview, TX 77530 • (32.1 miles) • Full Time • 9/9/2026
Benefits:401(k)401(k) matchingCompetitive salaryDental insuranceFree uniformsHealth insuranceOpportunity for advancementPaid time offTraining & developmentVision insurancePosition Summary: The standard function of the position is to build, program, deploy, and service our Mobile Security Trailers (MSTs). The position requires that the candidate is able to adjust to a fast-paced market where last-minute movements happen often. The candidate will need to be able to work with minimal supervision and provide great customer service. Duties And ResponsibilitiesInstall and service CCTV, batteries, solar panels, and solar controls.Maintain and service small engine gas powered generators.Must have a strong work ethic and ability to work well with other team members.Provides reliable, high quality cThompson Safety, LLC
Houston, TX 77066 • (12.6 miles) • Full Time • 9/9/2026
Job Summary:The Fire Alarm Technicianis responsible forthe installation, testing, inspection, service, and repair of fire alarm systems. Respond to emergency and maintenance calls and troubleshoot/replace faulty devices to restore alarm panels to “normal condition”.Complete inspection and service reports.Supervisory Responsibilities:NoneEssential Job Functions:Traveltocustomerlocationstoperforminstallation,service,andupgradesoffirealarmsystems.Respondtoemergencysituationsduringandafterbusinesshourstoresolvesafetyconcerns.PerformAnnualandSemi-annualinspectionofLifeSafetySystems.Write and provide inspection/service reports on tested equipment and devices.Indicate any deficiencies or corrections that need tobemade.TroubleshootanddiagnosefaultsormalfunctionsinfirealarmsystemsandtakeappropriatePreferred Technologies, LLC
Houston, TX 77093 • (20.4 miles) • Full Time • 9/9/2026
Why Pref-Tech?Voted "Top Workplaces" by Houston Chronicle and Austin American Statesman, 2 years in a row! We aim to make “family” a core reason we attract incredible people, retain them, and collectively deliver unequaled quality and service to customers. If your heart and mind are pushing you to join a team who deeply desires to be the best in the world, has a long-game approach to business, prides itself on doing exceptional work, celebrates service to others, and is willing to invest in you, you should consider Pref-Tech.Position Overview: This role is in Corpus Christi for an O&G facility. The Security Technician 2 at Pref-Tech will be responsible for installing access control, IP-based and analog video management systems, intrusion, and auto-gate equipment. Scope of duties include, bDigi Security Systems
Houston, TX • (24.7 miles) • Full Time • 9/9/2026
Digi Security Systems is an industry leader in the design, installation and support of custom video surveillance, electronic access control, and intrusion detection solutions for public and private partners. We've built our reputation on innovation and reliable service, and we're known as the industry's experts.Position OverviewDigi Security Systems is seeking an experienced low voltage Project Manager to oversee the planning and execution of high-level commercial security systems projects. A PMP certification (or equivalent project management certification) required.This role involves managing teams responsible for installation, service, troubleshooting, and programming of systems including video surveillance, electronic access control, and intrusion detection. Preference will be given toPower Plus
Houston, TX 77041 • (20.1 miles) • Full Time • 9/8/2026
Are you a lead-generating, prospecting, relationship-building, sales machine? Do you love the challenge of discovering potential clients, reaching out to them, and maintaining relationships? If so, we should talk.We arePower Plus!A multi-industry leader in providing power when you need it, where you need it through intelligent and efficient power solutions. We work with Fortune 100 companies across the country such as Amazon, Wal-Mart, Costco, and more. We’ve built a more than 35-year reputation for excellence through our commitment to developing our people, providing exceptional, relationship-based customer service, and giving back to the community. Our biggest differentiator is the quality of our people, and the working environment we create for them, which really has to be seen to be beEnchanted Rock Management LLC
Houston, TX 77002 • (27 miles) • Full Time • 9/8/2026
Description: We are ERock!ERock is a leader and innovator in distributed energy. ERock has responded to long-term trends in electricity by becoming the first smart-grid supplier to US energy consumers. The company installs, operates, and integrates its highly flexible, low-cost, and quick-response distributed generation to increase reliability and stability, reduce costs and decrease carbon footprint.At ERock, our backup generators ensure that customers will never be without power, allowing their business to operate normally when there is an outage in the area. Our innovative approach provides customers with highly reliable, ultra-clean backup generation at a fraction of the cost of traditional backup solutions. We seek those who share our commitment to customer service, innovation, and inNational Collaboration Security, LLC
Houston, TX 77021 • (31.1 miles) • Full Time • 9/7/2026
Benefits/PerksCareer Advancement OpportunitiesCompetitive CompensationFlexible ScheduleJob SummaryWe are seeking a professional Security Guard to join our team. In this role, your primary responsibility will be to create a safe and secure environment. You will protect our premises, assets, and employees and prevent any illegal or inappropriate occurrences. The ideal candidate has experience with public safety and security and operates with a high degree of integrity at all times.ResponsibilitiesPatrol the premises and maintain a high level of visibilityMonitor entrances and exits to ensure only authorized personnel access the facilityRemove trespassers when necessaryMonitor surveillance camerasRespond to reports of suspicious activityReport on daily activities and any security incidentsQuaQuanex
Houston, TX 77024 • (25.4 miles) • Full Time • 9/5/2026
Quanex is looking for aCybersecurity Manager in Houston, TX or Akron, OH.The Cybersecurity Manager will be responsible for oversight, monitoring, and alerting all aspects of the Quanex cybersecurity environment. This position will have direct reports and will be responsible for the cybersecurity program of the business.We Offer You!Competitive Salary401K Match w/ 2-year vesting periodBonus PotentialMedical, Dental & Vision PlansPaid Time Off & HolidaysVarious Work SchedulesTuition AssistanceWellness/Fitness ResourcesTraining/DevelopmentEmployee Stock Purchase PlanDynamic Culture & People - just to name a few!What’s attractive about the Cybersecurity Manager position?Lead and strengthen Quanex’s enterprise cybersecurity program, helping protect critical systems, data, and global operations.SwimJim Texas
Houston, TX 77042 • (27.9 miles) • Full Time • 9/5/2026
SwimJim Texas is a year-round, indoor, heated facility looking to interview future SwimJim super hero lifeguards and swim coaches! We are looking for individuals who can add to our already fun and dynamic team. We are a team consisting of individuals who genuinely enjoy working with one another and have great work ethic and believe in making every day, a positive one!Our mission is to help prevent drowning in a Happier, Healthier and Safer method.We are looking for excited individuals who understand the importance of water safety and keeping swimmers safe. We are looking for individuals who take pride in their duties and responsibilities as lifeguards and swim instructors. All swim instructor training is done in-house. Give us the opportunity to train you with the tools necessary to becomeCharlie Mike Protective Services
Houston, TX 77056 • (26.8 miles) • Full Time • 9/4/2026
Unarmed Security Officer$25/hour | Childress, TX | Housing, Transportation & Meals Provided | W-2 Employment | Growth Into Armed & Executive Protection | Full-Time OpportunitiesThis position is assigned toChildress, Texas. Transportation, lodging, and meals are provided. Team members may stay on-site for extended periods depending on project schedules. Candidates from Dallas, Amarillo, and surrounding areas are encouraged to apply.You represent the client, the company, and the standard every time you step on site.You stay alert, communicate professionally, handle pressure without losing composure, and take ownership without needing someone to constantly manage you.This is not a “sit around and collect a check” security position.At* Charlie Mike Protection,* we are building a team of dependZona Facta Collective
Houston, TX 77001 • (32.3 miles) • Full Time • 9/4/2026
Zona Facta CollectivePosition: Level III ATM Protection AgentLocation: Houston, TX (Hybrid)Department: OperationsCompensation: $20.00/hour | Weekly Direct DepositEmployment Type: 1099 Independent ContractorJob OverviewZona Facta Collective is currently seeking qualified Level III Armed Security Agents for multiple security contracts across Texas. We have an immediate need for our ATM Technician Security Contract in the Greater Houston area. Agents will be responsible for escorting ATM technicians to ensure they can perform their tasks safely and without disruption.Key ResponsibilitiesEscort ATM technicians to and from job sites across the Greater Houston area.Ensure the safety of technicians during all assigned shifts.Remain on standby, ready to deploy at the start of each scheduled shift.J Holdings
Spring, TX 77388 • (5.3 miles) • Full Time • 9/4/2026
NON-COMMISSIONED Level 2 Security Guard Some alternating exterior foot patrols at some locations. Some locations require scans as part of the patrol. Must maintain communications with dispatch during shift. Prior security, military or LE experience a plus - an excellent opportunity for retirees. Required gear (must bring to interview): - Must have current security license or at least 1 year of security experience. Required: The experience required for these positions includes, but is not limited to: - Must be professional in appearance, skillset, and attitude. - Must be at least 21 years of age. - Must have reliable and dependable transportation. - Must have a smartphone. - MUST BE ABLE TO START IMMEDIATELY!!! - All employees must be able to pass a criminal background check, reference/prevSolaris Oilfield Infrastructure, LLC
Houston, TX 77024 • (25.4 miles) • Full Time • 9/4/2026
Company Description About Solaris Energy Infrastructure Solaris Energy Infrastructure, Inc. (NYSE:SEI) provides scalable equipment-based solutions for use in distributed power generation as well as the management of raw materials used in the completion of oil and natural gas wells. Headquartered in Houston, Texas, Solaris serves multiple U.S. end markets, including energy, data centers, and other commercial and industrial sectors.Job Description About the OpportunitySolaris is building out networked power generation and distribution assets across multiple customer sites. Site networks reach down to turbine and balance-of-plant equipment, SCADA runs on Ignition, and protection and control includes SEL devices connected over SEL software-defined networking.This environment is being designedSecurity Guard Services
Houston, TX 77077 • (28.4 miles) • Full Time • 9/4/2026
Armed officer Hiring:Best to email Resume, Guard Card and Availability to: Responsibilities and Duties: Security officer tasks may include but not limited to:Securing premises and personnel by patrolling property; monitoring surveillance equipment; inspecting buildings, equipment, and access points; permitting entry. Obtains help by sounding alarms. Prevents losses and damage by reporting irregularities; informing violators of policy and procedures; restraining trespassers, identifying risks and notifying appropriate management authority or 911/Police. Completes reports by recording observations, information, occurrences, and surveillance activities. Maintain a written log of all daily activities per shift.Foxconn Industrial Internet - FII
Houston, TX 77064 • (15.5 miles) • Full Time • 9/3/2026
Security Control Room Coordinator (IB3) Location: Houston, TX 77064 Business Unit:CESBG Job Classification: None- Exempt SUMMAR Operation and supervision of technical equipment incontrol room in order to monitor persons, assets, and ongoing processes within the plant area, and to respond immediately to extraordinary events and emergency signals.Preparing daily reports on the operation and condition of the technical equipment managed, as well as on events occurring during the shift KEY RESPONSIBILITIESAlarm response: Operate installed technical devices, monitor signals, and prepare reports on triggering events. All relevant data must be documented (e.g., alarm, acknowledgment, intervention initiated, persons involved, detailed documentation of actions taken).Continuously monitor CCTV imagesQuality Security Services
Houston, TX 77001 • (32.3 miles) • Full Time • 9/3/2026
We are seeking Armed Security Officers to provide mobile escort services for client personnel as they travel to and from work locations and while performing sensitive on-site tasks. This is an on-call position that requires flexibility and professionalism. Officers do not handle or transport valuables the role is strictly focused on protecting people and ensuring a safe working environment.ResponsibilitiesEscort and safeguard client personnel during travel and onsite assignments.Provide a visible armed presence to deter threats while clients perform tasks.Remain alert to potential risks and respond appropriately to incidents.Maintain professional communication with dispatch, supervisors, and client personnel.Complete accurate daily activity and incident reports.Follow all company policies,MAGNETO & DIESEL INJECTOR SERVICE INC
Humble, TX 77338 • (14.2 miles) • Full Time • 9/2/2026
For the past 80+ years, M&Dhas led the aftermarket in remanufacturing innovation to address technological advancements and changing customer needs. In the past few decades, we have expanded beyond our remanufacturing roots to develop close (and sometimes exclusive) partnerships with the world’s leading OEMs and manufacturers.Those partnerships with key suppliers like Bosch, Garrett, Federal Mogul, Cummins, Stanadyne, Holset, BorgWarner, Delphi, Yanmar, Mitsubishi, Denso and others have been critical in honing our remanufacturing capabilities and expanding our parts offering to include new, no core options in fuel injectors and fuel pumps, diesel engine cylinder heads, blocks, crankshafts and connecting rods. M&D also stocks a complete assortment of turbos (new and remanufactured), inframeVirtuo Group Corporation
Houston, TX • (24.7 miles) • Full Time • 9/2/2026
Are you passionate about protecting organizations from cyber threats and helping shape the future of cybersecurity? Virtuo Group is seeking a skilled and motivated Cybersecurity Analyst to join our award-winning team. In this role, you’ll monitor, detect, and respond to security incidents, while working alongside experts who are dedicated to keeping our clients’ systems secure. If you thrive in a fast-paced, dynamic environment and enjoy solving complex challenges, this is the opportunity to make a real impact.Workdays & Hours: MONDAY – FRIDAY 8:00 AM – 5:00 PM* *Subject to Change / Remote is Not an OptionDESCRIPTION OF DUTIES / ESSENTIAL FUNCTIONSDuties, functions and responsibilities of this position include:Responsible for communicating cyber risks and recommendations to mitigate risksAdvanced Sentry LLC
Houston, TX 77002 • (27 miles) • Full Time • 9/2/2026
Description: Mobile Security Officer (Flexible / Part-Time)JOB DESCRIPTIONAdvanced Sentry LLC is seeking professional and dependable individuals for flexible mobile security assignments across Texas. This role is designed for individuals who are comfortable working independently and accepting assignments based on their availability.WHAT YOU’LL DOPerform mobile security assignments at client locationsMaintain a visible and professional presenceObserve, document, and report incidents or unusual activityProvide professional customer service when interacting with residents, staff, or clientsCommunicate clearly with dispatch and team membersWORK STRUCTUREThis is a flexible, part-time role with no guaranteed hoursYou are not required to accept assignmentsAssignments are offered as they become avAllied Fire Protection
Pearland, TX 77581 • (41.3 miles) • Full Time • 9/2/2026
ALARM INSTALLATION- CONSTRUCTION TECHNICIANJOB DESCRIPTIONJob Responsibilities include but are not limited to:Installation of fire alarm systems in residential, commercial, and industrial buildingsInstallation, service, and trouble-shooting of fire alarm systems along with all its related equipmentBe a leader: oversee, direct, and delegate appropriate tasks to fulfill project completion deadlines, meet scheduling requirements, and exceed the goals established by the fire alarm managerEnsure project results are achieved within financial and productivity budgetsAccurately complete, execute and process paperwork/electronic or paperless required by the office and corporate management systemsConduct/coordinate necessary testing of the system Ensure required certifications are completeInstruct aManhattanLife Insurance & Annuity Company
Houston, TX 77092 • (21.1 miles) • Full Time • 9/2/2026
Who we are: ManhattanLife Insurance and Annuity Company was founded in 1850, the Company’s longevity makes it one of the oldest and most reliable health and life insurance companies in the country. Operating successfully for over 175 years is a testimony to ManhattanLife’s enduring history, and an indicator of the reliability of our future. ManhattanLife’s headquarters are in Houston, TX and the company is continually growing with multiple office locations nation-wide. ManhattanLife offers attractive employee benefits starting day one, including immediate coverage under our health, dental and vision plans. We offer flexible schedules, including shortened hours on Fridays, free parking, company-wide events, professional development, and a company-wide wellness program. Scope and Purpose:WeGreen City Security
Houston, TX 77056 • (26.8 miles) • Full Time • 9/1/2026
We are Human-Powered. We work with the latest technology available in our field. Our officers are well-trained, elite and uphold our values of honesty, integrity, professionalism, joy and dependability.Detailed Job Post:We are hiring a professional and competent UNARMED security officer for a multifamily (apartment) site in Houston TX 77056. Wednesday, Friday, Saturday, Sunday, and Monday from 9pm-5am (40 hours per week). The pay rate for this position is $15.00 hourly. Working smart phone with active internet plan and a vehicle in good condition.Our mission is to bring peace of mind and order to our clients, employees and shareholders.Responsibilities:Perform access controls at gates.Foot patrol premises regularly to maintain order and establish a presence.Monitor and authorize entrance oU.S. Army
Houston, TX 77002 • (27 miles) • Full Time • 9/1/2026
Enlist as a Soldier into the United States Army and As a Radio and Communications Security Repairer, you’ll perform or supervise essential preventive maintenance checks and services on radios, transmitters, communication security equipment, and other associated equipment to ensure secure communication is always available. It’ll be your responsibility to calibrate and align equipment components, and use test, measurement, and diagnostic equipment. You’ll test program sets and use interactive electronic technical manuals to troubleshoot and repair equipment. This is not a civilian contractor position. No experience necessary. Position is entry level.REQUIREMENTS:A U.S. citizen or permanent resident with a valid Green Card 17 to 34 Years Old High School Diploma or GED Meet Tattoo Guidelines NFairfield Inn & Suites Houston Memorial City
Houston, TX 77043 • (23.4 miles) • Full Time • 8/31/2026
Description: Job SummaryThe Night Auditor is responsible for the preparation and disposition of all Night Audit work. Responsible for the front desk operation during the overnight shift (Typically 11pm-7am). Primary responsibilities include: registering guests, making reservations, preparing daily reports, balancing transactions, and conducting security walks.Education & ExperienceAt least 1 year of progressive experience in a hotel or a related field required.High School diploma or equivalent required.College course work in related field helpful.Previous supervisory responsibility preferred.Must be able to work independently and with minimal supervision.Knowledge of Accounting Principles.Must be able to problem solve and troubleshoot in order to resolve guest issues that may arise and resCity Of Conroe
Conroe, TX 77301 • (12.1 miles) • Full Time • 8/31/2026
JOB SUMMARYThe Lifeguard is responsible for the safety of patrons in the pool(s) and surrounding environments. Act as first responder in emergency situations. Provide customer service to all members, participants and guests. Follow and enforce all City of Conroe and Center policies and procedures. Participate in all in-service training sessions. Conduct various pool maintenance duties, including testing water chemistry and checking mechanical system operation. Complete all required records and reports.QUALIFICATIONSEducation and Experience:Minimum age of 15. Must be pursuing high school diploma or equivalent. Must possess current American Red Cross Certifications in Lifeguarding and CPR for the Professional Rescuer.Knowledge, Skills and Abilities: Knowledge of and up to date on all requireThe GEO Group
Conroe, TX 77301 • (12.1 miles) • Full Time • 8/29/2026
OverviewAre you looking for a career you can feel good about? We hire only those that strive to do their best. By joining our family, you'll receive the honor and recognition that comes with working for the industry's global leader in evidenced based rehabilitation.Who We Are:GEO provides complementary, turnkey solutions for numerous government partners worldwide across a spectrum of diversified correctional and community reentry services. From the development of state-of-the-art facilities and the provision of management services and evidence-based rehabilitation to the post-release reintegration and supervision of individuals in the community, GEO offers fully diversified, cost-effective services that deliver enhanced quality and improved outcomes.Why Work for GEO:We believe that work is