Johns Creek, GA • (44.6 miles) • Full Time • 9/12/2026

Join TRC Talent Solutions and play a key role in powering the industries of tomorrow. We’re looking for a skilled Wiring Technicianwho thrives in a team environment, takes pride in clean, accurate work, and is ready to make an impact Location: Alpharetta, GA Temp to hireShift : 4-day work with Monday - Thursday 5am - 3:30pm Overtime on Friday or SaturdayDuties:Interpret and work from electrical schematics to assemble and wire electric power system projects.Independently wire sub-panels, enclosures, door devices, and critical power equipment with minimal supervision.Neatly route harnesses, with or without wire loom following company wiring standards.Understand and work with both A/C and D/C voltages to perform complex wiring tasks efficiently and safely.Collaborate with Project Leads and S

Braselton, GA 30517 • (32 miles) • Full Time • 9/24/2026

Warehouse Computer Clerk/Forklift DriverShifts Available:1st Shift: 5:00am-1:30pm + Benefits.About Williams-Sonoma DC - Braselton, GA:Since it was founded in 1956, Williams - Sonoma has grown from Chuck Williams’ single store in Sonoma, CA into one of the largest retailers in the country, with some best known and most beloved brands in home furnishings, including Williams – Sonoma, Pottery Barn and West Elm.Our Distribution Centers serve as vital connections between factories and our retail, online and mail-order customers around the world. The Supply Chain environment is dynamic and fast-paced, and the network is expanding rapidly. If you have a background in distribution, manufacturing, engineering, transportation, finance, human resources, or home delivery – and are looking for a job wi

Gainesville, GA 30507 • (39.3 miles) • Full Time • 9/18/2026

Description: $1500 Bonus eligibleHealthy Hens, Healthy Eggs, Heathy Planet:At Pete & Gerry's, we were first to do it better, and are still doing it best. For nearly 30 years, we've been on a mission to produce healthy, delicious eggs and partner with family farms for meaningful impact. By raising hens outdoors as nature intended, we stay true to our roots every step of the way by keeping animal welfare, planet-friendly farming practices, and high-quality taste and nutrition at the heart of all we do, so you can always believe in what you buy.Healthy Together:At Pete & Gerry’s, we believe that when we care for each other, we all thrive. Across our farms, offices, and communities, we act as one flock united by respect, collaboration, and a shared commitment to doing what’s right. We create a

Lawrenceville, GA 30046 • (31.3 miles) • Full Time • 9/15/2026

Don’t see a specific job that matches your qualifications? Please fill out the general application as we are always looking to hire new talent to join the Peachtree Packaging & Display team!Benefits:Employer-paid basic life & long-term disability insuranceMedical, dental, & vision (employer pays 60% of premiums for employees & legal dependents)Supplemental life, short-term disability, accident & critical illness insurance plans also availableFSA (Medical & Dependent Care)401k (100% match up to 3% and 50% match on next 3% for a maximum contribution of 4.5% per year & fully vested at 90 days of employment)Paid holidays & paid time off*All benefits listed above are available at 90 days of continuous employment.Equal Opportunity Employer:Peachtree Packaging, Inc. supports equal employment oppo

Lawrenceville, GA 30043 • (33.9 miles) • Full Time • 9/29/2026

Openwork is currently engaged in a search to find a Product Research DeveloperinLawrenceville, GA.In this role, you will be responsible for interacting with customers, entering orders, and overall customer satisfaction. Apply today if you meet the qualifications listed below. In a Product Research Developerrole youll be responsible for:. Navigating Amazon & Ebay listings for the companyChecking quantity and inventory levels on listingsExcellent attention to detail.Able to utilize Google Sheets or Microsoft ExcelSupporting receiving functions within the warehouse What youll need: Strong knowledge of Amazon and eBay marketplaces.Strong inventory skills.Strong Microsoft Excel or Google Sheets skills.Excellent attention to detail.Experience with PPE, safety products, medical supplies, industri

Suwanee, GA 30024 • (40.2 miles) • Full Time • 9/29/2026

Job Title: Data Center Technician 3Duration: 12 MonthsWork Location: Suwanee GA and required to be onsite at the DC centerWork Site Type: OnsiteJob Description:THE ROLEIn this role the individual will work with external vendors and internal teams across business units to deliver industry leading Hardware Emulation and Prototyping datacenter solutions to allow the company to meet challenges in producing state of the art compute, graphics and adaptive silicon technologies.THE PERSONLooking for a detail-oriented individual with excellent communication skills to support and develop hardware emulation and prototyping datacenters and infrastructure. This position is part of Virtual Bring-Up (VBU) central methodology team.KEY RESPONSIBILITIES• LSF/Slurm administration and maintenance, analyzing j

Duluth, GA • (41 miles) • Full Time • 9/29/2026

Description:Hybrid 3 days/week in Duluth, GA with travel up to 30% Our client is seeking an experienced SAP S/4HANA Business Process Lead (BPL) with strong SAP process knowledge and the ability to understand business needs, analyze current-state processes, and translate those needs into clear business and technical requirements. This role partners closely with business stakeholders and a System Integrator in a “2-in-a-box” delivery model to support scalable, automated, and audit-ready ERP solutions across Quality (Incoming Inspection) and Manufacturing Operations (Capacity Planning) in a complex, multi-system manufacturing environment.We can facilitate W2 and corp-to-corp consultants. For our W2 consultants, we offer a great benefits package that includes Medical, Dental, and Vision benefi

McDonough, GA • (41.7 miles) • Full Time • 9/28/2026

If you think you would be a good addition to our team, please fill out this general application and submit your resume. We are always looking for people who have a passion for the automotive industry to join Bellamy Strickland!

Gainesville, GA 30501 • (44.1 miles) • Full Time • 9/28/2026

Description: We are seeking a highly experienced Senior Project Manager to lead land and site development projects throughout Georgia. This role is responsible for managing all phases of project deliveryfrom due diligence and entitlement through design, permitting, and construction supportwhile maintaining strong client relationships and ensuring successful project outcomes.The ideal candidate will bring in-depth knowledge of Georgia development regulations, strong leadership skills, and experience managing complex commercial, residential, and mixed-use projects.Key ResponsibilitiesProject Management & DeliveryLead and manage multiple land and site development projects simultaneouslyOversee project scope, schedules, budgets, and quality assuranceDirect multidisciplinary teams including civ

Tucker, GA 30084 • (41.1 miles) • Full Time • 9/28/2026

Performs Relay and Control functions requiring advanced electrical design of distribution substations and the selection and application of standard engineering techniques, guidelines, procedures, and standards. Works under the supervision of Supervisors and the Manager. (E-IV) Performs Relay and Control Design functions requiring advanced electrical design of GTC transmission and basic electrical design of generator interconnection facilities. Independently develops, designs, evaluates, selects and/or applies guidelines, procedures, engineering techniques and technical standards in an economically efficient and sound engineering manner; Exhibits full competency in most aspects of Relay & Control Design functions. Represents the Relay & Control Design functional area as an internal part of

Tucker, GA 30084 • (41.1 miles) • Full Time • 9/28/2026

OT Cybersecurity Engineer I-VProtect the Digital Infrastructure That Powers Georgia's Electric GridGeorgia System Operations Corporation (GSOC) is seeking an Security Operations Engineer to help protect the operational technology, digital infrastructure, and critical systems that support GSOC and Georgia Transmission Corporation (GTC) operations.This role sits at the intersection of operational technology, cybersecurity engineering, cyber risk management, and NERC Critical Infrastructure Protection (CIP) compliance. You will help strengthen the security and resilience of the systems and networks that support the safe and reliable operation of Georgia's electric grid.This opportunity is ideal for an engineer who enjoys solving complex technical problems, working across engineering and opera

Lawrenceville, GA • (31.4 miles) • Full Time • 9/27/2026

About Getfastshirt.comGetfastshirt.com is a fast-growing leader in the custom apparel and commercial printing industry, proudly delivering high-quality, versatile solutions for businesses, teams, events, and individuals. With a commitment to speed, precision, and customer satisfaction, we specialize in a full range of printing services including embroidery, direct-to-film (DTF) printing, screen printing. But we don’t stop at fabric. Our capabilities stretch across engraving, stickers, signage, and a wide array of commercial print solutions designed to elevate your image and message with precision and flair.Whether looking to outfit team with branded uniforms, create eye-catching promotional items, or bring unique design to life on apparel or signage, Getfastshirt.com combines advanced tech

Covington, GA • (20.9 miles) • Full Time • 9/27/2026

Company DescriptionAbsolics Inc. is the world's first glass substrate manufacturer and a leader in advanced packaging technologies. The company provides scalable solutions tailored for businesses in high-performance computing. Absolics pioneers innovative manufacturing techniques to support cutting-edge semiconductor advancements. Located in Covington, GA, the company is positioned at the forefront of the technology industry.Position: SPC Data Control EngineerLocation:COVINGTON, GAJOBSUMMARYDUTIES/RESPONSIBILITIES:SPC System Design and ImplementationProcess Monitoring and ControlData Collection and ManagementData Analysis and InterpretationREQUIREMENTS:Excellent analytical and problem-solving skillsSolid understanding of quality management principles, root cause analysis, and corrective ac

Tucker, GA 30084 • (41.1 miles) • Full Time • 9/27/2026

Job PurposeSupport profitable business growth with key customers by managing and successfully delivering new product development (NPD) projects. Lead cross-functional teams to develop projects that meet customers’ expectations and ensure projects are commercialized on time and in full.Essential Functions• Deliver customer-driven NPD projects for key customers on time and in full• Align with Sales and R&D on clear project briefs and understand the customer’s NPD process and milestones to ensure their expectations are met• Create and manage project timelines, lead team meetings, identify resource requirements, set expectations, assign tasks and responsibilities, follow up, and track/report progress• Lead cross-functional project team through NPD process and ensure adherence to key milestones

Peachtree Corners, GA 30092 • (44.5 miles) • Full Time • 9/27/2026

Description: The Project Coordinator is responsible for ensuring all mitigation and restoration projects are properly documented, compliant, and administratively complete. This role supports Project Managers and Operations by verifying job files, maintaining claim accuracy, managing required communications, and ensuring all stabilization and mitigation documentation is completed in a timely and professional manner.Requirements: Primary Duties & ResponsibilitiesFile & Documentation ManagementVerify that all required job photos are uploaded and meet company and insurance documentation standards.Review files in MICA and other internal systems for completeness and accuracy.Ensure claim numbers are obtained and properly entered into each job file.Confirm that scope notes and job notes have been

Dacula, GA • (27.8 miles) • Full Time • 9/27/2026

ASOCIADO DE LOGSTICA Y ALMACN Automation Personnel Services est buscando un Asociado de Logstica y Almacn para una empresa ubicada en Dacula, GA. En este puesto, tendr la oportunidad de desarrollar sus habilidades en logstica, control de inventario y manejo de materiales mientras forma parte de una compaa lder a nivel mundial en soluciones para la industria de la construccin. Salario $18.50 por hora Horario y Turno Lunes a Viernes, 12:00 PM – 8:30 PM,con horas extras segn sea necesario. Almuerzo: 4:00 PM – 4:30 PM Responsabilidades y Deberes delAsociado de Logstica y AlmacnRecibir, inspeccionar y procesar materiales devueltos por los clientes.Identificar y evaluar las condiciones de equipos y componentes devueltos.Tomar fotografas y documentar las devoluciones segn los procedimientos estab

Lawrenceville, GA • (31.4 miles) • Full Time • 9/26/2026

The Graphic Designer is responsible for following through on all customer graphics orders and will help with volume copying. In addition to effective conceptualization abilities, strong design skills, and technical expertise, the Graphic Designer must be highly collaborative by nature and must have demonstrated strengths in graphics design, project management, and communication. The ideal candidate has a Bachelor’s degree in visual communication, graphic design, or a related field; at least two years of experience in graphic design or in the print industry, and is skilled in copy-editing/proof-reading and desktop publishing. He or she must have full mastery of various software design programs including Adobe-based platforms (Acrobat, InDesign, Illustrator, and Photoshop) for both Mac and P

Norcross, GA 30093 • (40 miles) • Full Time • 9/26/2026

JobDescriptionSummary:TheITFieldTicketCoordinator’sresponsibilitiesaretoreceive,validate,schedulewithcustomer,plan,andassignticketstodesignatedfieldtechniciansforpartspick-upsandhardwareITrepairservices.TheITfieldticketcoordinatorwillcommunicatedirectlywiththedesignatedfieldtechniciansresponsibleforservicesaswellaswiththeend-customersrequestingservice.TheITFieldTicketCoordinatorwillberequiredtoadheretocontractualServiceLevelAgreements(“SLAs”).KeyResponsibilities:Receive, validate, update, and end-user requests for hardware repair services via ticketing system and in compliance with contractual SLAs.Schedulerepairserviceswithend-usersviaphoneand/ore-mail.Planandassigndesignatedfieldtechnicianstoend-userserviceticketsasefficientlyaspossible.Providecustomerservicesupportviaphoneand/ore-mail.C

Gainesville, GA 30501 • (44.1 miles) • Full Time • 9/26/2026

Hydro Extrusions is a world-leading aluminium extrusion business counting around 100 production sites in 40 countries and employing 20,000 people. Through our unique combination of local expertise, global network, and unmatched R&D capabilities, we can offer everything from standards profiles to advanced development and manufacturing for most industries.Since 1905, Hydro has turned natural resources into valuable products for people and businesses with focus on a safe and good workplace for our 30,000 employees in more than 140 locations.What we offer youMedical, Rx, Dental, Disability, Life Insurance, Flexible Spending AccountsRetirement Savings Plans with Company Match/ContributionsEducation AssistanceBonus Plan EligibilityParental LeaveWhat you will be doingJob Summary: The Reliability

Conyers, GA 30012 • (27.8 miles) • Full Time • 9/26/2026

Job Title: Senior Project ManagerJob DescriptionAs a Senior Project Manager, you will lead and consult with owners, general contractors, engineers, architects, vendors, subcontractors, and project stakeholders. You will be responsible for nurturing successful relationships to ensure project success and client satisfaction. You will manage the pre-construction, pre-planning, procurement, and construction project scheduling process. Your role will involve leveraging strong relationships with clients, contractors, and project partners to support successful project execution and future business opportunities.ResponsibilitiesManage subcontractors to ensure project timelines, budgets, quality standards, and client expectations are met.Take ownership and accountability for projects under your dir

Suwanee, GA • (38.6 miles) • Full Time • 9/26/2026

Job Title: Test TechnicianSuwanee, GA Pay: $19-$25/HourShift: 6a-5:30PMJob DescriptionThe Test Technician performs routine and specialized electrical tests on transformers, power metering products, power distribution units, and other integrated systems to verify that all products meet defined specifications. This role troubleshoots and resolves manufacturing and design issues in a timely manner to support product quality and customer satisfaction, while contributing to continuous improvement in processes and practices.ResponsibilitiesPerform routine and special electrical tests on transformers, power metering products, power distribution units, and other integrated systems to ensure products meet specifications.Assist in the assembly of products by reading and following electrical schemati

Decatur, GA 30035 • (39.6 miles) • Full Time • 9/26/2026

Raba Kistner, Inc. is a premier Engineering Consulting and Program Management firm. Our purpose is to build a better and more sustainable world for our employees, their families, our clients, and the communities we serve. Our Core Values are:Community “We care for our communities”Integrity “We act with integrity”Passion “We infuse passion into everything we do”Quality “We believe quality comes from a culture of innovation and continuous improvement”Growth “We dedicate ourselves to personal and business growth”Raba Kistner is seeking a dependable Project Manger IIto join our Infrastructure team in Decatur, GA. Under direction, responsible for all areas or project operations, as determined by the size and nature of the project, including construction inspection and material testing operation

Duluth, GA • (41 miles) • Full Time • 9/26/2026

Job Description Job DescriptionPropose, architect, and design RTL in Verilog for use in a mixed-signal integrated circuitContribute as part of a highly experienced team of engineers with extensive cross-functional skill setApply clocking controls, FSM design, low power techniques, and high-speed design conceptsParticipate in design, architecture, and verification reviewsOversee digital backend design, including synthesis, static timing analysis, and logic equivalence checkingCreate documentation targeting design, verification, and test teamsAssist with the proposal, definition, documentation, and implementation of new featuresMentor and train junior engineers and New College Grad engineersQualifications QualificationsEducation:Bachelor or Master's degree in Electrical Engineering, Computer

Flowery Branch, GA 30542 • (38.3 miles) • Full Time • 9/25/2026

Prime Retail Services is a nationwide retail construction General Contractor helping brands bring their spaces to life with precision and professionalism. Since 2003, we’ve delivered retail construction solutions for Fortune 500 companies and growing brands across the United States.The Construction Senior Project Manager leads project teams and day-to-day operations to deliver projects safely, on time, within budget, and to client expectations. This role requires strong leadership, financial discipline, client communication, procurement oversight, and the ability to develop team members while driving operational excellence and change.ESSENTIAL FUNCTIONSManage people, processes, and daily project operations to execute assigned projects successfully.Assign and monitor team responsibilities w

Tucker, GA 30084 • (41.1 miles) • Full Time • 9/25/2026

Role SnapshotThis position is responsible for the complete execution of Capital Projects. It encompasses all aspects of project functions including project development, engineering/design, procurement, construction, budget/actual management and reporting, commissioning, startup and testing of capital projects that are required at new generation sites or OPC's existing power generation fleet with a capital expenditure over $10 million. This position may be responsible for managing multiple simultaneous projects. This position directs projects to ensure safety, environmental, budget, and schedule goals are met. This position may be responsible for the management of contracted project managers based on active project volume within the PMO.Works directly with Supervisor/Contractors/Project Tea

Pendergrass, GA 30567 • (32.6 miles) • Full Time • 9/25/2026

POSITION SUMMARYThe Senior Software Engineer will spearhead the development of software solutions in logistics. This position will play a crucial role in shaping the technical direction of projects and ensuring the overall success of software development initiatives within the organization. This individual will leverage their expertise to design, implement, integrate, and maintain systems for efficient processes within the assigned function area (i.e. manufacturing, distribution, finance, etc.). This position will lead and collaborate with cross-functional and international teams to drive innovations.CORE FUNCTIONSLead the design and architecture of complex software systems, ensuring scalability, maintainability, and performance.Lead cross-functional and international teams.Collaborate wit

Lawrenceville, GA 30043 • (33.9 miles) • Full Time • 9/25/2026

Company Description At National Vision we believe everyone deserves to see their best to live their best. We help people by making quality eye care and eyewear more affordable and accessible. National Vision is one of the largest optical retail companies in the United States with over 1,200 stores. We operate four retail brands: America’s Best Contacts & Eyeglasses, Eyeglass World, and Vista Optical inside select Fred Meyer stores and on select military bases. We offer an innovative culture where training is a priority, hard work is praised, and career growth is a reality.We are hiring for a Sr Manager, Oracle Fusion Applications to join our growing team!Job Description We are seeking an experienced, highly skilled Sr. Manager, Oracle Applications to serve as the senior techno-functional o

Norcross, GA 30071 • (42.1 miles) • Full Time • 9/25/2026

Applicants must be authorized to work for ANY employer in the U.S.We are unable to sponsor or take over sponsorship of an employment Visa currently.No agencies please.This hybrid role requires onsite presence at the Norcross HQ twice per week.USAN is an innovative contact center solutions provider, a respected community leader, and an all-around great place to work. We promote work-life effectiveness for all our employees by creating a supportive, flexible, and collaborative work environment. We have a high-performance culture, where we treat our employees as individuals, as professionals, as key members of the team, and like family.We are seeking highly motivated DevOps people to join a small, fast-moving DevOps team responsible for building, automating, securing, and operating cloud-nati

Norcross, GA • (42.1 miles) • Full Time • 9/25/2026

Description: About usSack is redefining the industry, experiencing explosive growth year after year with no signs of stopping! As the fastest-growing MEPF, millwright, and rigging company in the South, we’re building the future with innovation. We offer competitive pay, great benefits, and the perfect place to launch and grow your career.Job ResponsibilitiesWe are seeking an Electrical Project Manager to join our construction firm. As part of our team, you oversee multiple crews and implement the installation of large-scale electrical systems. You manage work sequencing, interpret blueprints and schematics, and ensure safe and timely completion of all projects. This role requires strong leadership and organizational skills, and our ideal candidate possesses significant prior experience org

Ellenwood, GA 30294 • (43.4 miles) • Full Time • 9/25/2026

As a leading mechanical contractor serving the Southeast and Midwest, Batchelor & Kimball takes pride in partnering with our clients to deliver excellent results from engineering and construction to operations and maintenance. We offer design/build and turnkey construction services, including teaming with subcontractor partners. If you are looking to grow your career and thrive in a team environment, then we invite you to apply for this position.There’s not a lot of BS here, and not a lot of turnover. Good people work at Batchelor & Kimball. We’re good at our jobs, and good to each other. We have high expectations because the work is challenging, but we know the most valuable thing about the work is the people who do it. If this sounds like a good fit for you, we’d like to meet you!If you

Lawrenceville, GA 30046 • (31.3 miles) • Full Time • 9/24/2026

Entry-Level Cable TechnicianNo Experience Required | Paid Training | Company Vehicle | Weekly PayBuild a Career That Connects PeopleLooking for more than just another job? Want a career where you're paid to learn, work independently, and have unlimited earning potential?At CUI Cable Services, we're looking for motivated individuals who enjoy working with their hands, solving problems, and helping customers stay connected. Whether you're starting your career or looking for a fresh opportunity, we'll provide the paid training, tools, and support you need to become a successful Telecommunications Technician.No cable experience? No problem. If you have a great attitude and a strong work ethic, we'll teach you everything you need to know.Why You'll Love Working at CUIWe Invest in Your Success

Duluth, GA 30097 • (41.6 miles) • Full Time • 9/24/2026

Benefits:Opportunity for advancementTraining & developmentWellness resources DigiOffice is seeking a sharp, self-directed Intune Endpoint & Mobility Engineer with proven, production-level hands-on experience in both Microsoft Intune and VMware Workspace ONE / AirWatch. This is a dual-platform engineering position not a monitoring role, not a ticket-routing role. You will own, operate, and troubleshoot a complex enterprise endpoint and mobility environment supporting a national logistics and transportation operation where device uptime directly impacts freight movement and business continuity. If you have built, administered, and independently troubleshot both Intune and Workspace ONE in production and can solve complex endpoint problems without step-by-step direction this role was written

Duluth, GA 30097 • (41.6 miles) • Full Time • 9/24/2026

WEG Coatings Manitowoc, WICompany Description: WEG Coatings LLC., located in Manitowoc, WI, is a privately owned and operated company that custom formulates, develops, manufactures, sells, and applies high-performance coatings. These include Phenolics, Epoxies, Epoxy Phenolics, Urethanes and Polyesters. Founded in 1935, the company is the manufacturer of the finest corrosion control coatings and serves customers world-wide.We are a service-oriented company that strives to be on the cutting edge of the coatings industry. We take great pride in the satisfaction of our customers thus requiring a dynamic, personable, independent individual who can work well with our customers and staff. WEG Coatings is made up of a talented, versatile team focused on continuous improvement.The Data Entry Clerk

Avondale Estates, GA 30002 • (42.9 miles) • Full Time • 9/24/2026

Description: WHO WE ARE Working together, growing together, creating new things together: EDAG connects people and the future. Company and workforce share the same vision. With a familiar atmosphere and at the same time the potential of a global world-class development company. You‘ll go your own way in your career at a high level – nationally and internationally. Take your next step and support us as a VEHICLE ENGINEERING PROGRAM MANAGERDESCRIPTIONLead and manage a team of program analysts, providing guidance, support, and mentorship to drive exceptional performanceLead problem-solving activities for engineering challenges, leveraging competitive benchmarking, business case analysis, cost & weight initiatives, and market/customer analysisPrepare and deliver frequent reports to upper- and

Athens, GA 30601 • (20.9 miles) • Full Time • 9/24/2026

Job Title: Pharmacovigilance Systems Analyst Location: Athens, GA Type: 21 month contract Compensation: $30-34/hour, depending on qualifications Work Model: Onsite – onsite Hours: 40.0OverviewProvide operational and administrative support for pharmacovigilance systems, including system maintenance, user support, data management, validation activities, and documentation. This role supports global PV users and ensures the reliable operation of GxP-regulated safety systems.ResponsibilitiesProvide first-line support for pharmacovigilance system users, including ticket triage, user setup, access support, mailbox management, and training coordination. Maintain pharmacovigilance system data, including product dictionaries, product families, product lines, and related database records. Execute SQL

Jackson, GA • (40 miles) • Full Time • 9/24/2026

Together We Build – Partnership, Innovation, Excellence, and SafetyAt Kelso Industries, 5,000+ employees across 40+ companies work together to deliver exceptional HVAC, mechanical, plumbing, refrigeration, and electrical solutions nationwide. Join us to grow your career, make an impact, and be part of a team where innovation, excellence, and safety come first.Recruiter Notice: We respectfully ask external recruiters and staffing agencies not to submit candidates. We only accept direct applications.Wallace Electric Company is actively seeking an "Accomplished" AND "Results-Driven" Project Executive for their operations team. Our ideal candidate will have a proven track record and stable employment history. The Project Executive is responsible for the overall leadership, strategic direction,

Jackson, GA • (40 miles) • Full Time • 9/24/2026

We're not just offering a job, we're inviting you to be part of a team built on PARTNERSHIP, INNOVATION, EXCELLENCE, and SAFETY at Wallace Electric.PARTNERSHIP means we work together with trust, loyalty, and an owner mindset, always striving for win-win outcomes.INNOVATION drives us to think differently and create real value in everything we do.EXCELLENCE pushes us to set high expectations and deliver exceptional results.SAFETY is our foundationboth physical and psychological safety matter every single day.If you're looking for a place where you can grow your career, be valued for who you are, and contribute to something meaningful, we'd love to have you on our team.We are part of Kelso Industries, which is comprised of 25+ (and growing) market-leading operating companies with over 2,600 e

Duluth, GA 30096 • (40 miles) • Full Time • 9/24/2026

United Merchant Services, Inc. (dba Bluu) is a New Jersey-based, comprehensive payment processing company for merchants nationwide. UMS continues to introduce innovative payment products and services to merchants and its commitment to excellent customer service has made UMS one of the top private payment processors in the nation.We are looking for an Application Processor with Excel experience to join our Team!Responsibilities Receive, review, and enter data in a payment service or POS application into internal and external systems during a new account boarding process in accordance to established procedures. Prepare for source documents for underwriting Communicate with business partners and customers to resolve incomplete application packages Data entry on the systems of processing relat

Buford, GA 30518 • (40.3 miles) • Full Time • 9/24/2026

What We’re AboutAt Reeves Young, everything we do – from 30 feet below the ground to 30 floors above – is about people. The culture we cultivate spreads throughout our employees and flows into the relationships we build with our clients, owners, and business partners. We pride ourselves in celebrating the accomplishments of our staff and promoting growth through challenging our employees each and every day. Whether it’s in the boardroom or at the ping-pong table, we are making an impact on the construction industry. Don’t just read what we’re about, join our team and see for yourself. What We OfferAmazing Coworkers Competitive Pay Full Benefits including Medical, Dental, Vision and more 401(K) Matching Paid Time Off Company Celebrations & Events Office Snacks On-Site Fitness Facility What

Duluth, GA • (41 miles) • Full Time • 9/24/2026

Company Description Salary rate: $80,000~/yr, DOELocation: Duluth, GAEmployment Type: Full-timeWork Arrangement: On-site**Korean Bilingual Required**Job Description We are seeking a Connected Car Service (CCS) Operations Developer to support the operation, maintenance, and enhancement of connected vehicle services and related data-processing systems.This position will focus on processing large volumes of data using Python, supporting ETL workflows, and developing and maintaining Java-based applications. The ideal candidate will have experience in backend development, data processing, system operations, and technical troubleshooting.Key ResponsibilitiesSupport the daily operation and maintenance of Connected Car Service systemsProcess and manage large volumes of data using PythonDevelop and

Duluth, GA 30097 • (41.6 miles) • Full Time • 9/24/2026

Infrastructure Network Engineer Location:Duluth, GA (On-site) Job Type: Full-Time Salary: Based on experienceBenefits: 100% Employer Paid Medical, Dental, Vision | 401K Match | PTO & Holidays | Paid Lunch | Relocation Assistance | Bonus Opportunity About Us SK AX USA, Inc. is a leading global IT service provider and subsidiary of SK Group, one of South Korea’s largest conglomerates. Our U.S. Headquarters supports a range of industries, including IT consulting, digital transformation, and cloud services. We are looking for a skilled Infrastructure Network Engineer to join our IT infrastructure team and support mission-critical network operations. Learn more about SK AX USA: https://www.skaxus.com Position Overview We are seeking a highly skilled Infrastructure Network Engineer to design, im