Braselton, GA 30517 • (29.1 miles) • Full Time • 9/24/2026

Warehouse Computer Clerk/Forklift DriverShifts Available:1st Shift: 5:00am-1:30pm + Benefits.About Williams-Sonoma DC - Braselton, GA:Since it was founded in 1956, Williams - Sonoma has grown from Chuck Williams’ single store in Sonoma, CA into one of the largest retailers in the country, with some best known and most beloved brands in home furnishings, including Williams – Sonoma, Pottery Barn and West Elm.Our Distribution Centers serve as vital connections between factories and our retail, online and mail-order customers around the world. The Supply Chain environment is dynamic and fast-paced, and the network is expanding rapidly. If you have a background in distribution, manufacturing, engineering, transportation, finance, human resources, or home delivery – and are looking for a job wi

Gainesville, GA 30507 • (34.4 miles) • Full Time • 9/18/2026

Description: $1500 Bonus eligibleHealthy Hens, Healthy Eggs, Heathy Planet:At Pete & Gerry's, we were first to do it better, and are still doing it best. For nearly 30 years, we've been on a mission to produce healthy, delicious eggs and partner with family farms for meaningful impact. By raising hens outdoors as nature intended, we stay true to our roots every step of the way by keeping animal welfare, planet-friendly farming practices, and high-quality taste and nutrition at the heart of all we do, so you can always believe in what you buy.Healthy Together:At Pete & Gerry’s, we believe that when we care for each other, we all thrive. Across our farms, offices, and communities, we act as one flock united by respect, collaboration, and a shared commitment to doing what’s right. We create a

Lawrenceville, GA 30046 • (34.2 miles) • Full Time • 9/15/2026

Don’t see a specific job that matches your qualifications? Please fill out the general application as we are always looking to hire new talent to join the Peachtree Packaging & Display team!Benefits:Employer-paid basic life & long-term disability insuranceMedical, dental, & vision (employer pays 60% of premiums for employees & legal dependents)Supplemental life, short-term disability, accident & critical illness insurance plans also availableFSA (Medical & Dependent Care)401k (100% match up to 3% and 50% match on next 3% for a maximum contribution of 4.5% per year & fully vested at 90 days of employment)Paid holidays & paid time off*All benefits listed above are available at 90 days of continuous employment.Equal Opportunity Employer:Peachtree Packaging, Inc. supports equal employment oppo

Lawrenceville, GA 30043 • (35.8 miles) • Full Time • 9/29/2026

Openwork is currently engaged in a search to find a Product Research DeveloperinLawrenceville, GA.In this role, you will be responsible for interacting with customers, entering orders, and overall customer satisfaction. Apply today if you meet the qualifications listed below. In a Product Research Developerrole youll be responsible for:. Navigating Amazon & Ebay listings for the companyChecking quantity and inventory levels on listingsExcellent attention to detail.Able to utilize Google Sheets or Microsoft ExcelSupporting receiving functions within the warehouse What youll need: Strong knowledge of Amazon and eBay marketplaces.Strong inventory skills.Strong Microsoft Excel or Google Sheets skills.Excellent attention to detail.Experience with PPE, safety products, medical supplies, industri

Suwanee, GA 30024 • (41.6 miles) • Full Time • 9/29/2026

Job Title: Data Center Technician 3Duration: 12 MonthsWork Location: Suwanee GA and required to be onsite at the DC centerWork Site Type: OnsiteJob Description:THE ROLEIn this role the individual will work with external vendors and internal teams across business units to deliver industry leading Hardware Emulation and Prototyping datacenter solutions to allow the company to meet challenges in producing state of the art compute, graphics and adaptive silicon technologies.THE PERSONLooking for a detail-oriented individual with excellent communication skills to support and develop hardware emulation and prototyping datacenters and infrastructure. This position is part of Virtual Bring-Up (VBU) central methodology team.KEY RESPONSIBILITIES• LSF/Slurm administration and maintenance, analyzing j

Duluth, GA • (43.7 miles) • Full Time • 9/29/2026

Description:Hybrid 3 days/week in Duluth, GA with travel up to 30% Our client is seeking an experienced SAP S/4HANA Business Process Lead (BPL) with strong SAP process knowledge and the ability to understand business needs, analyze current-state processes, and translate those needs into clear business and technical requirements. This role partners closely with business stakeholders and a System Integrator in a “2-in-a-box” delivery model to support scalable, automated, and audit-ready ERP solutions across Quality (Incoming Inspection) and Manufacturing Operations (Capacity Planning) in a complex, multi-system manufacturing environment.We can facilitate W2 and corp-to-corp consultants. For our W2 consultants, we offer a great benefits package that includes Medical, Dental, and Vision benefi

Gainesville, GA 30501 • (39.3 miles) • Full Time • 9/28/2026

Description: We are seeking a highly experienced Senior Project Manager to lead land and site development projects throughout Georgia. This role is responsible for managing all phases of project deliveryfrom due diligence and entitlement through design, permitting, and construction supportwhile maintaining strong client relationships and ensuring successful project outcomes.The ideal candidate will bring in-depth knowledge of Georgia development regulations, strong leadership skills, and experience managing complex commercial, residential, and mixed-use projects.Key ResponsibilitiesProject Management & DeliveryLead and manage multiple land and site development projects simultaneouslyOversee project scope, schedules, budgets, and quality assuranceDirect multidisciplinary teams including civ

Lawrenceville, GA • (34.2 miles) • Full Time • 9/27/2026

About Getfastshirt.comGetfastshirt.com is a fast-growing leader in the custom apparel and commercial printing industry, proudly delivering high-quality, versatile solutions for businesses, teams, events, and individuals. With a commitment to speed, precision, and customer satisfaction, we specialize in a full range of printing services including embroidery, direct-to-film (DTF) printing, screen printing. But we don’t stop at fabric. Our capabilities stretch across engraving, stickers, signage, and a wide array of commercial print solutions designed to elevate your image and message with precision and flair.Whether looking to outfit team with branded uniforms, create eye-catching promotional items, or bring unique design to life on apparel or signage, Getfastshirt.com combines advanced tech

Covington, GA • (30.8 miles) • Full Time • 9/27/2026

Company DescriptionAbsolics Inc. is the world's first glass substrate manufacturer and a leader in advanced packaging technologies. The company provides scalable solutions tailored for businesses in high-performance computing. Absolics pioneers innovative manufacturing techniques to support cutting-edge semiconductor advancements. Located in Covington, GA, the company is positioned at the forefront of the technology industry.Position: SPC Data Control EngineerLocation:COVINGTON, GAJOBSUMMARYDUTIES/RESPONSIBILITIES:SPC System Design and ImplementationProcess Monitoring and ControlData Collection and ManagementData Analysis and InterpretationREQUIREMENTS:Excellent analytical and problem-solving skillsSolid understanding of quality management principles, root cause analysis, and corrective ac

Dacula, GA • (29.2 miles) • Full Time • 9/27/2026

ASOCIADO DE LOGSTICA Y ALMACN Automation Personnel Services est buscando un Asociado de Logstica y Almacn para una empresa ubicada en Dacula, GA. En este puesto, tendr la oportunidad de desarrollar sus habilidades en logstica, control de inventario y manejo de materiales mientras forma parte de una compaa lder a nivel mundial en soluciones para la industria de la construccin. Salario $18.50 por hora Horario y Turno Lunes a Viernes, 12:00 PM – 8:30 PM,con horas extras segn sea necesario. Almuerzo: 4:00 PM – 4:30 PM Responsabilidades y Deberes delAsociado de Logstica y AlmacnRecibir, inspeccionar y procesar materiales devueltos por los clientes.Identificar y evaluar las condiciones de equipos y componentes devueltos.Tomar fotografas y documentar las devoluciones segn los procedimientos estab

Lawrenceville, GA • (34.2 miles) • Full Time • 9/26/2026

The Graphic Designer is responsible for following through on all customer graphics orders and will help with volume copying. In addition to effective conceptualization abilities, strong design skills, and technical expertise, the Graphic Designer must be highly collaborative by nature and must have demonstrated strengths in graphics design, project management, and communication. The ideal candidate has a Bachelor’s degree in visual communication, graphic design, or a related field; at least two years of experience in graphic design or in the print industry, and is skilled in copy-editing/proof-reading and desktop publishing. He or she must have full mastery of various software design programs including Adobe-based platforms (Acrobat, InDesign, Illustrator, and Photoshop) for both Mac and P

Gainesville, GA 30501 • (39.3 miles) • Full Time • 9/26/2026

Hydro Extrusions is a world-leading aluminium extrusion business counting around 100 production sites in 40 countries and employing 20,000 people. Through our unique combination of local expertise, global network, and unmatched R&D capabilities, we can offer everything from standards profiles to advanced development and manufacturing for most industries.Since 1905, Hydro has turned natural resources into valuable products for people and businesses with focus on a safe and good workplace for our 30,000 employees in more than 140 locations.What we offer youMedical, Rx, Dental, Disability, Life Insurance, Flexible Spending AccountsRetirement Savings Plans with Company Match/ContributionsEducation AssistanceBonus Plan EligibilityParental LeaveWhat you will be doingJob Summary: The Reliability

Suwanee, GA 30024 • (41.6 miles) • Full Time • 9/26/2026

Industrial Design-Build and General ContractingWe are seeking an experienced Preconstruction Manager responsible for supporting the BD team. The focus will be on budget development, while bridging the communications between the clients and the Project Executive Team. The role will oversee the budget development process, coordinates with design partners, sub-contractors, and operations staff to create an environment for successful project acquisition and delivery. The Role’s Duties & Responsibilities1.BUSINESS DEVELOPMENT SUPPORT·Manage budget & proposal development in coordination with Business development and in-house estimating/engineering staffs to create effective customer relationships.·Establish and maintain relationships with architects, clients, sub-contractors, local jurisdiction,

Norcross, GA 30093 • (44.4 miles) • Full Time • 9/26/2026

JobDescriptionSummary:TheITFieldTicketCoordinator’sresponsibilitiesaretoreceive,validate,schedulewithcustomer,plan,andassignticketstodesignatedfieldtechniciansforpartspick-upsandhardwareITrepairservices.TheITfieldticketcoordinatorwillcommunicatedirectlywiththedesignatedfieldtechniciansresponsibleforservicesaswellaswiththeend-customersrequestingservice.TheITFieldTicketCoordinatorwillberequiredtoadheretocontractualServiceLevelAgreements(“SLAs”).KeyResponsibilities:Receive, validate, update, and end-user requests for hardware repair services via ticketing system and in compliance with contractual SLAs.Schedulerepairserviceswithend-usersviaphoneand/ore-mail.Planandassigndesignatedfieldtechnicianstoend-userserviceticketsasefficientlyaspossible.Providecustomerservicesupportviaphoneand/ore-mail.C

Conyers, GA 30012 • (35.4 miles) • Full Time • 9/26/2026

Job Title: Senior Project ManagerJob DescriptionAs a Senior Project Manager, you will lead and consult with owners, general contractors, engineers, architects, vendors, subcontractors, and project stakeholders. You will be responsible for nurturing successful relationships to ensure project success and client satisfaction. You will manage the pre-construction, pre-planning, procurement, and construction project scheduling process. Your role will involve leveraging strong relationships with clients, contractors, and project partners to support successful project execution and future business opportunities.ResponsibilitiesManage subcontractors to ensure project timelines, budgets, quality standards, and client expectations are met.Take ownership and accountability for projects under your dir

Suwanee, GA • (40.1 miles) • Full Time • 9/26/2026

Job Title: Test TechnicianSuwanee, GA Pay: $19-$25/HourShift: 6a-5:30PMJob DescriptionThe Test Technician performs routine and specialized electrical tests on transformers, power metering products, power distribution units, and other integrated systems to verify that all products meet defined specifications. This role troubleshoots and resolves manufacturing and design issues in a timely manner to support product quality and customer satisfaction, while contributing to continuous improvement in processes and practices.ResponsibilitiesPerform routine and special electrical tests on transformers, power metering products, power distribution units, and other integrated systems to ensure products meet specifications.Assist in the assembly of products by reading and following electrical schemati

Duluth, GA • (43.7 miles) • Full Time • 9/26/2026

Job Description Job DescriptionPropose, architect, and design RTL in Verilog for use in a mixed-signal integrated circuitContribute as part of a highly experienced team of engineers with extensive cross-functional skill setApply clocking controls, FSM design, low power techniques, and high-speed design conceptsParticipate in design, architecture, and verification reviewsOversee digital backend design, including synthesis, static timing analysis, and logic equivalence checkingCreate documentation targeting design, verification, and test teamsAssist with the proposal, definition, documentation, and implementation of new featuresMentor and train junior engineers and New College Grad engineersQualifications QualificationsEducation:Bachelor or Master's degree in Electrical Engineering, Computer

Flowery Branch, GA 30542 • (36.2 miles) • Full Time • 9/25/2026

Prime Retail Services is a nationwide retail construction General Contractor helping brands bring their spaces to life with precision and professionalism. Since 2003, we’ve delivered retail construction solutions for Fortune 500 companies and growing brands across the United States.The Construction Senior Project Manager leads project teams and day-to-day operations to deliver projects safely, on time, within budget, and to client expectations. This role requires strong leadership, financial discipline, client communication, procurement oversight, and the ability to develop team members while driving operational excellence and change.ESSENTIAL FUNCTIONSManage people, processes, and daily project operations to execute assigned projects successfully.Assign and monitor team responsibilities w

Lula, GA 30554 • (40 miles) • Full Time • 9/25/2026

The Project Coordinator plays a crucial role in bridging field operations, administrative support, and customer communications. This position works directly with operational leadership and management to plan, schedule, track, and support ongoing industrial plumbing, excavation, and piping projects from inception to final site cleanup.Key Responsibilities: Project & Operations SchedulingCoordinate daily job schedules for field personnel, plumbers, equipment operators, jetter trucks, and sub-contractors.Assist field management with job dispatching, resource allocation, and timeline tracking for emergency and scheduled work.Maintain clear communication channels between field operations, leadership, and industrial clients.Material, Equipment, & Logistics CoordinationSource, order, and track de

Pendergrass, GA 30567 • (27.2 miles) • Full Time • 9/25/2026

POSITION SUMMARYThe Senior Software Engineer will spearhead the development of software solutions in logistics. This position will play a crucial role in shaping the technical direction of projects and ensuring the overall success of software development initiatives within the organization. This individual will leverage their expertise to design, implement, integrate, and maintain systems for efficient processes within the assigned function area (i.e. manufacturing, distribution, finance, etc.). This position will lead and collaborate with cross-functional and international teams to drive innovations.CORE FUNCTIONSLead the design and architecture of complex software systems, ensuring scalability, maintainability, and performance.Lead cross-functional and international teams.Collaborate wit

Lawrenceville, GA 30043 • (35.8 miles) • Full Time • 9/25/2026

Company Description At National Vision we believe everyone deserves to see their best to live their best. We help people by making quality eye care and eyewear more affordable and accessible. National Vision is one of the largest optical retail companies in the United States with over 1,200 stores. We operate four retail brands: America’s Best Contacts & Eyeglasses, Eyeglass World, and Vista Optical inside select Fred Meyer stores and on select military bases. We offer an innovative culture where training is a priority, hard work is praised, and career growth is a reality.We are hiring for a Sr Manager, Oracle Fusion Applications to join our growing team!Job Description We are seeking an experienced, highly skilled Sr. Manager, Oracle Applications to serve as the senior techno-functional o

Athens, GA 30601 • (10.2 miles) • Full Time • 9/24/2026

Job Title: Pharmacovigilance Systems Analyst Location: Athens, GA Type: 21 month contract Compensation: $30-34/hour, depending on qualifications Work Model: Onsite – onsite Hours: 40.0OverviewProvide operational and administrative support for pharmacovigilance systems, including system maintenance, user support, data management, validation activities, and documentation. This role supports global PV users and ensures the reliable operation of GxP-regulated safety systems.ResponsibilitiesProvide first-line support for pharmacovigilance system users, including ticket triage, user setup, access support, mailbox management, and training coordination. Maintain pharmacovigilance system data, including product dictionaries, product families, product lines, and related database records. Execute SQL

Lawrenceville, GA 30046 • (34.2 miles) • Full Time • 9/24/2026

Entry-Level Cable TechnicianNo Experience Required | Paid Training | Company Vehicle | Weekly PayBuild a Career That Connects PeopleLooking for more than just another job? Want a career where you're paid to learn, work independently, and have unlimited earning potential?At CUI Cable Services, we're looking for motivated individuals who enjoy working with their hands, solving problems, and helping customers stay connected. Whether you're starting your career or looking for a fresh opportunity, we'll provide the paid training, tools, and support you need to become a successful Telecommunications Technician.No cable experience? No problem. If you have a great attitude and a strong work ethic, we'll teach you everything you need to know.Why You'll Love Working at CUIWe Invest in Your Success

Duluth, GA 30097 • (43.9 miles) • Full Time • 9/24/2026

Benefits:Opportunity for advancementTraining & developmentWellness resources DigiOffice is seeking a sharp, self-directed Intune Endpoint & Mobility Engineer with proven, production-level hands-on experience in both Microsoft Intune and VMware Workspace ONE / AirWatch. This is a dual-platform engineering position not a monitoring role, not a ticket-routing role. You will own, operate, and troubleshoot a complex enterprise endpoint and mobility environment supporting a national logistics and transportation operation where device uptime directly impacts freight movement and business continuity. If you have built, administered, and independently troubleshot both Intune and Workspace ONE in production and can solve complex endpoint problems without step-by-step direction this role was written

Duluth, GA 30097 • (43.9 miles) • Full Time • 9/24/2026

WEG Coatings Manitowoc, WICompany Description: WEG Coatings LLC., located in Manitowoc, WI, is a privately owned and operated company that custom formulates, develops, manufactures, sells, and applies high-performance coatings. These include Phenolics, Epoxies, Epoxy Phenolics, Urethanes and Polyesters. Founded in 1935, the company is the manufacturer of the finest corrosion control coatings and serves customers world-wide.We are a service-oriented company that strives to be on the cutting edge of the coatings industry. We take great pride in the satisfaction of our customers thus requiring a dynamic, personable, independent individual who can work well with our customers and staff. WEG Coatings is made up of a talented, versatile team focused on continuous improvement.The Data Entry Clerk

Buford, GA 30518 • (40.1 miles) • Full Time • 9/24/2026

What We’re AboutAt Reeves Young, everything we do – from 30 feet below the ground to 30 floors above – is about people. The culture we cultivate spreads throughout our employees and flows into the relationships we build with our clients, owners, and business partners. We pride ourselves in celebrating the accomplishments of our staff and promoting growth through challenging our employees each and every day. Whether it’s in the boardroom or at the ping-pong table, we are making an impact on the construction industry. Don’t just read what we’re about, join our team and see for yourself. What We OfferAmazing Coworkers Competitive Pay Full Benefits including Medical, Dental, Vision and more 401(K) Matching Paid Time Off Company Celebrations & Events Office Snacks On-Site Fitness Facility What

Duluth, GA 30096 • (43.2 miles) • Full Time • 9/24/2026

United Merchant Services, Inc. (dba Bluu) is a New Jersey-based, comprehensive payment processing company for merchants nationwide. UMS continues to introduce innovative payment products and services to merchants and its commitment to excellent customer service has made UMS one of the top private payment processors in the nation.We are looking for an Application Processor with Excel experience to join our Team!Responsibilities Receive, review, and enter data in a payment service or POS application into internal and external systems during a new account boarding process in accordance to established procedures. Prepare for source documents for underwriting Communicate with business partners and customers to resolve incomplete application packages Data entry on the systems of processing relat

Duluth, GA • (43.7 miles) • Full Time • 9/24/2026

Company Description Salary rate: $80,000~/yr, DOELocation: Duluth, GAEmployment Type: Full-timeWork Arrangement: On-site**Korean Bilingual Required**Job Description We are seeking a Connected Car Service (CCS) Operations Developer to support the operation, maintenance, and enhancement of connected vehicle services and related data-processing systems.This position will focus on processing large volumes of data using Python, supporting ETL workflows, and developing and maintaining Java-based applications. The ideal candidate will have experience in backend development, data processing, system operations, and technical troubleshooting.Key ResponsibilitiesSupport the daily operation and maintenance of Connected Car Service systemsProcess and manage large volumes of data using PythonDevelop and

Duluth, GA 30097 • (43.9 miles) • Full Time • 9/24/2026

Infrastructure Network Engineer Location:Duluth, GA (On-site) Job Type: Full-Time Salary: Based on experienceBenefits: 100% Employer Paid Medical, Dental, Vision | 401K Match | PTO & Holidays | Paid Lunch | Relocation Assistance | Bonus Opportunity About Us SK AX USA, Inc. is a leading global IT service provider and subsidiary of SK Group, one of South Korea’s largest conglomerates. Our U.S. Headquarters supports a range of industries, including IT consulting, digital transformation, and cloud services. We are looking for a skilled Infrastructure Network Engineer to join our IT infrastructure team and support mission-critical network operations. Learn more about SK AX USA: https://www.skaxus.com Position Overview We are seeking a highly skilled Infrastructure Network Engineer to design, im

Winterville, GA 30683 • (10.4 miles) • Full Time • 9/23/2026

About the OpportunityLocation: Bailey Nurseries locationsSchedule: Seasonal, full-time internship opportunities may vary by location and departmentFLSA Status: Non-Exempt – Paid InternshipGrow Your Future with Bailey NurseriesAt Bailey Nurseries, we believe our people are the root of our success. That's why our internship program is designed to do more than provide work experience. We offer meaningful opportunities for students to learn, contribute, build professional skills, and explore career paths in an innovative and growing organization.Whether you're passionate about horticulture, business, technology, marketing, operations, or people, you'll gain hands-on experience working alongside industry professionals who are committed to helping you grow.As a Bailey Nurseries intern, you won't

Pendergrass, GA 30567 • (27.2 miles) • Full Time • 9/23/2026

NeoVolta Power, LLC is building one of the next-generation battery manufacturing platforms in the United States and we’re looking for talented individuals to help power the future of energy.Our Georgia facility is designed for gigawatt-scale production of advanced battery energy storage systems supporting AI data centers, renewable integration, and grid stability. Backed by strong industry partnerships and global technical expertise, we offer the unique opportunity to join a high-growth manufacturing environment where your work directly shapes the future of clean energy infrastructure.At NeoVolta Power, we foster a culture grounded in fairness, transparency, compliance, and respect for every employee’s contribution because building the future of energy starts with empowering the people who

Duluth, GA • (43.7 miles) • Full Time • 9/23/2026

37676383 Data Analyst V, Duluth, GA 1 year Contract Sigma, Inc is looking for a Data Analyst V to work onsite at our client's location in Duluth, GA. Note : Flexibility exists to work out of any of the BIAH sites (Athens GA, Johns Creek GA, Gainesville GA, St Joseph MO, Ames IA)Duties :Performs Pharmacovigilance signal detection and analysis including generation of monthly and quarterly trending reports.Performs data analysis and report generation for ad hoc requests for PV information to support regulatory authority requests and stakeholder support (marketing, quality, external customers, etc.).Contributes to other PV product surveillance and risk management activities as needed SkillsPerforms Pharmacovigilance signal detection and analysis including generation of monthly and quarterly tr

Lawrenceville, GA 30046 • (34.2 miles) • Full Time • 9/23/2026

Overview Company Overview:Deposita(TM), An Allied Universal(R) Company has perfected the art of cash management using world-class innovation, technology, and tailored solutions. We serve customers in retail, wholesale and banking sectors through in-depth consultations. We ensure every security need is met and exceeded every step of the way. Join our Phenomenal team today! Job Description Deposita, an Allied Universal® Company, is hiring a Senior Director, Implementation.The Senior Director, Implementation is a commercial operations leader with full ownership of the planning, scheduling, budgeting, and successful delivery of cash recycler implementations for new and existing customers. This position carries direct financial accountability for the implementation portfolio, including project

Athens, GA • (6.6 miles) • Full Time • 9/22/2026

Under broad supervision, designs, codes, tests, modifies and debugs computer software. Is seeking consulting services to assist with completing a priority project to migrate IBM Cognos reports to Microsoft Power BI along with additional Power BI dashboard development work within our Enterprise Data Management and Analytics (EDMA) team. Below are the core areas the consultant will work on: The first priority is to migrate all production Cognos reports to Power BI. Currently we have approximately 400 Cognos reports with Oracle databases serving as the data source. The Cognos reports are used to support data collections managed by EDMA team and self-service reports to support the USG system office. The consultant will be responsible for migrating Cognos reports by developing equivalent or enh

Lawrenceville, GA • (34.2 miles) • Full Time • 9/22/2026

Job Description:Responsible for administration, management, and configuration of the Accela Automation SaaS platform, including modules like Citizen Access, Mobile Office, and GIS integration.Develop and customize applications, forms, workflows, and reports based on business requirements.Create scripts and code to extend platform capabilities using JavaScript, .NET, and APIs.Support integration of Accela with third-party systems such as GIS, payment gateways, and ERP platforms.Provide technical support to both IT teams and end-users, troubleshooting and documentation. Requirements for the Senior Accela Administrator: 3-5 years experience in Accela Administration, API integrations, and constructive scripting.Strong understanding of application development processes, project management, and

Buford, GA 30519 • (34.4 miles) • Full Time • 9/22/2026

Ardurra is hiring a Senior Project Manager for our Watershed practice in Atlanta, GA.Our engineers and scientists are passionate experts in urban stormwater management and ecological restoration. With over 27 years of history as a focused municipal stormwater practice, Ardurra is a trusted leader for providing reliable and innovative stormwater solutions across the Southeast. We pride ourselves on tailored and cost-effective approaches to protect public safety, improve watershed functions, and enhance quality of life for the communities we serve.Do you want to guide and grow a local team in watershed planning and capital project design for our municipal clients? Do you want to be part of a growing regional team that is delivering marquis projects for clients across the Southeast? Apply!Pri

Conyers, GA 30013 • (35.7 miles) • Full Time • 9/22/2026

C+K Plastics Georgia Quality Assurance InspectorDEPARTMENT:QualityREPORTING TO:QA ManagerResponsibilitiesSupports the QMS and understand the requirements of ISO 9001:2015Assists management in the Quality Improvement System (QIS).Performs Incoming Material Inspections with business system entriesPerforms First Piece InspectionPerform in-process inspections and test audits on product.Document all findings accuratelyHelps in the training of plant personnel.Follows all Safety Policies.Follows all Plant rules.Working understanding of Quality toolsUpdate records and forms.Data entry using Microsoft Excel.Communicate and Work with all levels of plant personnel.Required Education / Experience / SkillsHave some experience in ISO 9001:20152 years’ experience working in Quality Assurance.Must be able

Duluth, GA 30095 • (43.3 miles) • Full Time • 9/22/2026

Our client, Xstrahl, is a global leader in the design and manufacture of Superficial Orthovoltage Medical X-ray Systems used in the treatment of cancers and dermatological disorders, with expertise extending to advanced X-ray systems for pre-clinical radiation biology research. With manufacturing facilities in the United States and the United Kingdom, an international network of distributors, more than 800 systems in the field, and roughly 55 new installations each year, Xstrahl is at the forefront of medical and scientific advancement, and its customers depend on it long after the sale closes.About the RoleXstrahl doesn't yet have a dedicated help desk. Customer tickets are currently triaged by our Quality Assurance/Regulatory Affairs (QARA) team, whose job is to determine whether a ticke

Comer, GA 30629 • (22.4 miles) • Full Time • 9/22/2026

Day-based role working for an automotive manufacturing business. Direct hire & Salary Responsibilities Investigate quality issues and lead corrective actions.Monitor control plans, inspections, and quality procedures.Analyze quality data and identify process improvements.Support customer, supplier, and internal audits.Approve quality documentation, product releases, deviations, and rework.Stop production when quality or safety concerns arise. Requirements ISO9001 manufacturing Quality Engineering experience.Knowledge of 8D, FMEA, SPC, APQP, and PPAP.Strong problem-solving and communication skill

Suwanee, GA 30024 • (41.6 miles) • Full Time • 9/22/2026

POSITION SUMMARY:This position is responsible for providing support and direction to controls development and engineering and will manage the software development team, whose scope of responsibility includes managing software development resources for both firmware development and cloud software development; working closely with project managers to ensure on time delivery of projects; mentoring and guiding software developers for career growth; conducting team member reviews; and managing day-to-day tasks.The essential functions of the position include, but not limited to the following:Serves as the liaison between engineering management and customers.Provides support in developing business cases for new product development, and in justifying possible development costs for same.Ensures tha

Lilburn, GA • (42 miles) • Full Time • 9/22/2026

Test Technician - Contract To Hire An electronic component manufacturing company is seeking a skilled Test Technician in the Lilburn, GA area who will play a crucial role in ensuring the quality of printed circuit board assemblies (PCBAs) for various industries, including aerospace and defense. Shift of the Test Technician: 7:00AM - 3:30PM Pay Rate of the Test Technician: $25-$33/hr Responsibilities of the Test Technician:Set up, operate, and troubleshoot various test equipment including ICT and FCT.Read and interpret schematics and engineering work instructions for accurate testing.Document and report test failures to support root cause analysis.Maintain accurate test records and documentation in compliance with AS9100D.Support first article inspection and new product introduction test ac