Broomall, PA 19008 • (39.1 miles) • Full Time • 10/15/2026

Job Summary:The Fire Alarm Technicianis responsible forthe installation, testing, inspection, service, and repair of fire alarm systems. Respond to emergency and maintenance calls and troubleshoot/replace faulty devices to restore alarm panels to “normal condition”.Complete inspection and service reports.Supervisory Responsibilities:NoneEssential Job Functions:Traveltocustomerlocationstoperforminstallation,service,andupgradesoffirealarmsystems.Respondtoemergencysituationsduringandafterbusinesshourstoresolvesafetyconcerns.PerformAnnualandSemi-annualinspectionofLifeSafetySystems.Write and provide inspection/service reports on tested equipment and devices.Indicate any deficiencies or corrections that need tobemade.Troubleshootanddiagnosefaultsormalfunctionsinfirealarmsystemsandtakeappropriate

Berkeley Heights, NJ • (40.4 miles) • Full Time • 10/15/2026

ABOUT BATHHOUSEBathhouse is where the sauna meets the social scene. Thermal pools, steam rooms, and elite hands-on treatments all in a sleek, high-energy space. We're the intersection of wellness and social. Equal parts sanctuary and scene.We build spaces where anyone, with any body, can show up and feel better leaving than they arrived.JOB DESCRIPTIONBathhouse is seeking an attentive, safety-minded, and detail-oriented Lifeguard Attendant to help keep our pools, saunas, and wet areas clean, monitored, and well-maintained throughout the day and evening. This role is an essential part of our operations, ensuring guests feel cared for and safe while enjoying the space, and supporting a calm, welcoming environment at all times.RESPONSIBILITIESMonitor pools, hot/cold plunges, and wet areas to

Trenton, NJ • (9.7 miles) • Full Time • 10/15/2026

Job Title: Senior Cloud Security ArchitectLocation: Trenton, NJWork Arrangement: Hybrid – 3 days onsite and 2 days remoteDuration: 3 Months, with potential for extensionExperience: 10+ YearsJob Description We are seeking an experienced Senior Cloud Security Architect to design and implement enterprise cloud security frameworks, governance standards, and DevSecOps solutions across AWS, Azure, and multi-cloud environments. The ideal candidate will have extensive cloud security architecture experience, strong expertise in security integration across the software development lifecycle, and experience working in government or regulated environments.Key Responsibilities Design and implement cloud security architectures, policies, standards, and governance frameworks.Assess cloud security posture

Lakehurst, NJ 08733 • (15.8 miles) • Full Time • 10/15/2026

JOB SUMMARYSpecialty Systems, Inc. has an immediate opening for a Senior Information Systems Security Officer (ISSO) to join our team of technical professionals supporting our Department of Defense customer at Joint Base McGuire-Dix-Lakehurst (JB MDL), NJ. In this position, you will play a key technical role in the development, integration, accreditation, and sustainment of complex, mission-critical Department of Defense systems.The Senior ISSO will serve as the primary technical lead responsible for planning, developing, coordinating, and maintaining Risk Management Framework (RMF) authorization packages, including driving new systems through the Authorization to Operate (ATO) process. This position requires a hands-on cybersecurity professional capable of translating DoD/DoN security req

Clark, NJ 07066 • (39 miles) • Full Time • 10/15/2026

Why Turtle?At Turtle, we’re redefining what it means to be an industry leader in electrical distribution, and we want you to be part of our exciting journey! For over 100 years, we’ve built a reputation for innovation, excellence, and exceptional customer serviceand we’re just getting started. We are a diverse, passionate team spread across the US, Canada, Mexico, and Puerto Rico, committed to growth, learning, and creating opportunities for each other. At Turtle, every day is a chance to make a real difference, solve complex challenges, and push the boundaries of what’s possible. We believe in fostering an environment that inspires collaboration and sparks creativity, where employees are empowered to contribute to our mission and shape the future of the industry. If you're looking for a f

Princeton, NJ 08540 • (17.1 miles) • Full Time • 10/14/2026

Benefits:Flexible scheduleFree food & snacksFree uniformsTraining & developmentMake waves and pave the way for your career. At Goldfish Swim School we are not only passionate about building confident lifelong swimmers, we are also passionate about building the careers of our team members. We believe that the hard work and dedication of our team members help create skills that will last a lifetime. We take time to develop both personal and professional skills that prepare team members for their future careers. Perks and Benefits:Paid on-the-job trainingFlexible schedulingCulture driven companyEmployee recognition programsPrimary Responsibilities:Keep swimmers safe with lifeguard supervisionProvide any first aid necessaryJob Qualifications and SkillsAbility to work with childrenExcellent com

Philadelphia, PA • (26.9 miles) • Full Time • 10/14/2026

Protecting What Matters With Precision and PurposeLinked Alarm is a locally trusted, rapidly growing security and life safety integrator with locations in the Philadelphia and Tampa Bay areas. We specialize in commercial and residential installation and service of fire alarms, security systems, access control, CCTV, intercoms, and low-voltage infrastructure. Known for our responsive service, skilled team, and community-first approach, we’re seeking a Low Voltage Service Technician to help us continue delivering peace of mind to the clients who depend on us.What You’ll DoAs an Installation Technician at Linked Alarm, you’ll be the go-to expert for installing low-voltage systems including fire alarms, intrusion systems, access control, intercoms, and surveillance. You’ll work with a team and

Lansdowne, PA 19050 • (34.9 miles) • Full Time • 10/14/2026

Our Lansdowne YMCA is currently hiring for Lifeguards and Aquatic Instructors. Shift hours and days will vary.POSITION SUMMARY: Maintains safe swimming conditions in the pool, deck, and surrounding areas. Provides direct leadership, instruction, and motivation for students in swimming classes. Creates a positive atmosphere that promotes member safety and engagement in accordance with YMCA policies and procedures.ESSENTIAL FUNCTIONS:Maintains active surveillance of the pool area while pool is in operation. Performs lifeguard duties with Lifeguard II and/or Head Lifeguard.Instructs swimming lessons in accordance with YMCA guidelines, having prepared lesson plans accordingly.Knows/reviews all emergency procedures and responds to emergency situations immediately in accordance with YMCA policie

Mount Holly, NJ 08060 • (10.6 miles) • Full Time • 10/14/2026

New Brunswick Counseling Center (NBCC) is seeking a reliable and professional MMU Delivery Driver/Security to support our Mobile Medication Unit (MMU) program at the Mount Holly location.This position plays a vital role in ensuring safe, consistent, and stable operations through direct service support to clients and staff. The MMU Driver/Security is responsible for the safe transportation of Mobile Medication Unit staff, maintaining a secure environment, and supporting outreach and engagement efforts in the community.This individual will also assist in establishing and maintaining a safe milieu around the Mobile Unit, including ensuring all vehicle safety systems are operational and performing routine security and safety checks.Responsibilities:Safely operate the MMU vehicle to transport s

Englishtown, NJ 07726 • (19.7 miles) • Full Time • 10/14/2026

Professional, Mature and Responsible lifeguards needed to work in two upscale country clubs in Manalapan and Long Branch. Weekend hours are mandatory. flexile scheduling.

Lakewood, NJ 08701 • (23.6 miles) • Full Time • 10/14/2026

Security Team Lead (Technical & Compliance)Why Digacore?We'rea fast-paced, people-first MSP with:Real career growthAutonomy to own projects and make decisionsA collaborative culture (we back each other up, no egos)Paid certifications, ongoing training, and leadership that invests in your successRecognized as one of New Jersey's Top Workplaces for 2026About the RoleThe Security Team Lead is a hands-on technical role responsible for leading day-to-day security operations, guiding our Security Analysts, and drivingDigacore'scompliance initiatives (HIPAA, SOC 2, cyber insurance requirements, and related frameworks).What You'll DoProvide day-to-day technical direction and hands-on support to Security Analysts, working incidents and investigations directly alongside themServe as the primary esca

Trenton, NJ 08628 • (14 miles) • Full Time • 10/13/2026

We provide swim instruction to our community that builds confidence and develops safety skills in a student-centered environment. We are committed to training our staff to be safe around the water, giving them the tools they need to be successful. This is a diverse, inclusive and supportive workplace. Why Choose Swim?You get to impact the lives of kids and familiesIt's a fun, creative, flip flop friendly environmentEvery day is different with new opportunities to make a difference As a lifeguard you are responsible for the safety of everyone in and around the pool. You must remain alert throughout your entire shift, monitoring pool activities to enforce all safety guidelines. You will need a lifeguard and first aid/CPR certification and may need a pre-employment physical and skills test. Y

South Amboy, NJ 08879 • (31 miles) • Full Time • 10/13/2026

POSITION SUMMARY:Under the supervision of the Aquatic Director/Assistant Aquatic Director or Pool Manager, the lifeguards will be responsible for the safety of all members during the hours of pool operation by being on deck, actively patrolling the pool area, constantly remaining alert and scanning, enforcing all pool rules, and other duties as assigned by the Director, Assistant Director or Pool Manager.ESSENTIAL FUNCTIONS:1. Ensure all health and safety guidelines are strictly adhered to.2. Ensure safety of members and patrons and prevent injuries by actively guarding and supervising of pools by active scanning and patrolling.3. Ensure the pool is safe and staffing is within YMCA standards when taking responsibility for the pool and when exiting off of duty.4. Ensure your personal protec

Newtown Square, PA 19073 • (42.8 miles) • Full Time • 10/13/2026

Benefits:Lap swimmingFlexible scheduleTraining & development Lifeguards wanted! Searching for opening, weekday, weeknight and weekend lifeguards. SSC is located in Newtown Square, PA. Must be able to reasonably commute to the position. The candidate must have CPR, First Aid, and Lifeguard certifications. Also be able to submit background checks. Salary is hourly, part time and is commensurate with experience. Please send resume to Matt Sawicki at orand include contact information, hours of availability and potential start date. All inquiries about the position and submitted resumes will remain confidential. Suburban Seahawks Club (SSC) is a non-profit, 300+ member, competitive aquatics, USA Swimming Silver Medal Club. SSC’s primary location is a club owned, 25 yard 8-lane pool with a 2 lan

Toms River, NJ 08753 • (27.8 miles) • Full Time • 10/13/2026

Description: Full job descriptionAqua-Tots Swim Schools of Toms River, NJ, on Hooper Ave. offers world-class swimming lessons for children four months old and up in our year-round, indoor, 90-degree pool.We are looking for Certified Lifeguards. We are willing to certify the right candidate!Benefits-eligible full-time and part-time positions are available.Requirements: Lifeguard Job Requirements:Must be at least 17 years of age with a driver's licenseCurrent Lifeguard Certification, including first aid, CPR, AED, a plusPart-time positions require a minimum of 3 weekly shifts, including 2 weekday shifts (AM or PM) and 1 Saturday shift (AM).Weekday AM shifts are 8:30am - 1:00 pm; Weekday PM shifts are 3:00 pm - 8:00 pmSaturday AM Shift 8:30am - 1:00pm, Saturday Mid Shift 12:30pm - 4:30pm and

Lakewood, NJ 08701 • (23.6 miles) • Full Time • 10/12/2026

Entry-Level Fire/Security Alarm TechnicianLakewood, NJFull-TimeAt Reliable Safety Systems, Inc. we provide advanced fire and security solutions that protect businesses, properties, and communities. We are committed to building strong teams by investing in training and professional growth. We are seeking motivated individuals to join us as Entry-Level Fire/Security Alarm Technicians no prior industry experience required, just a willingness to learn and grow.Qualifications• High school diploma or equivalent.• Interest in electronics, safety systems, or technical trades.• Problem-solving skills and attention to detail.• Excellent communication and customer service abilities.• Valid driver’s license and reliable transportation.• Willingness to complete company-provided training and pursue cert

Springfield, NJ 07081 • (43.7 miles) • Full Time • 10/12/2026

Benefits:Competitive salaryDental insuranceEmployee discountsFree uniformsHealth insuranceOpportunity for advancementPaid time offTraining & development Are you looking for a great gig where the work is actually fun? Do you want to work somewhere you can get real job experience and make a difference? Check out Goldfish Swim School! We’re a rapidly growing, award winning franchise that is not your typical company! We change lives. We help children reach their goals. We wear flip flops. We work in a 90-degree pool. We love our employees and reward hard work with shout awards, gift cards and fun social events! We offer paid training and flexible shifts that are perfect for students or folks who want to grab extra hours without working late nights. Even better? Due to the rapid growth of our s

Philadelphia, PA 19112 • (31.8 miles) • Full Time • 10/10/2026

Global Resource Solutions, Inc. (GRS) is seeking an enthusiastic, motivated, detail orientated, and talented individual for the position of Information System Security Engineer III.Job Description:Summary:The Information System Security Engineer (ISSE) III, is primarily responsible for conducting information system security engineering activities with a focus on lifecycle of current systems and future requirement scoping. The position will collect and process the captured information security requirements and ensures that the requirements are effectively integrated into information systems through purposeful security architecting, design, development, and configuration. The position is an integral part of the development team designing and developing organizational information systems or u

Oaks, PA 19456 • (43 miles) • Full Time • 10/10/2026

Benefits:Free uniformsCompany partiesEmployee discountsFlexible scheduleFree food & snacks Are you looking for a great gig where the work is actually fun? Do you want to work somewhere you can get real job experience and make a difference? Check out Goldfish Swim School! We're a rapidly growing, award-winning franchise that is not your typical company! We love our employees and reward hard work with shout awards, gift cards, and fun social events! We offer paid training and flexible shifts that are perfect for students or folks who want to grab extra hours without working late nights. Even better? Due to the rapid growth of our school, advancement opportunities exist for the right candidate. Benefits: Leadership rolesFlexible hoursGreat payValuable work experienceIncreased social opportuni

Princeton, NJ 08540 • (17.1 miles) • Full Time • 10/10/2026

Description: An exciting opportunity to join the Team of a progressive YMCA association located in vibrant Somerset County, New Jersey. The YMCA is one of the nation’s leading nonprofit organizations dedicated to strengthening communities through youth development, healthy living and social responsibility. With a 150-year-old history, Greater Somerset County YMCA (GSCY) is a pillar of the community and has seven locations across three counties, which collectively serve upwards of 30,000 individuals. GSCY has 100 full-time and 950 part-time employees along with operating revenues to $22+ million.The Y empowers everyoneno matter who they are or where they are from. To fulfill our purpose of strengthening community for all, GSCY is committed to being an inclusive organization and leveraging o

Philadelphia, PA 19103 • (30.1 miles) • Full Time • 10/10/2026

Now Hiring: Security Operations ManagerLocation: Philadelphia, PAEmployment Type: Full-TimeSalary:$65,000 per yearJoin the Colonial Security Services Team!Colonial Security Services is seeking a motivated and experienced Security Operations Manager to oversee daily security operations throughout the Philadelphia area. This leadership role is responsible for ensuring exceptional client service, managing security personnel, maintaining compliance, and supporting business growth.If you're an organized leader who thrives in a fast-paced environment and is passionate about developing teams, we'd love to hear from you.Responsibilities: Manage the daily operations of multiple security contracts and client sites.Schedule personnel and ensure all shifts are properly staffed.Conduct site visits, ins

Eatontown, NJ 07724 • (32.6 miles) • Full Time • 10/10/2026

Description: POSITION SUMMARY:The Network and Security Engineer is responsible for designing, implementing, and supporting secure enterprise network environments, combining hands-on expertise in Cisco security technologies with strong routing and switching skills. This role leads security-focused engagements involving Cisco Secure Firewall/Firepower Threat Defense (FTD), Firepower Management Center (FMC), Cisco Identity Services Engine (ISE), and related network security technologies across enterprise LAN, WAN, wireless, data center, and cloud-connected environments.In this role, you will support the full engagement lifecycle from discovery and assessment through design, implementation, testing, knowledge transfer, and operational handoff. You will partner with architects, engineers, proje

Perth Amboy, NJ 08861-3940 • (34.1 miles) • Full Time • 10/10/2026

Description: The Raritan Bay Area YMCA is currently accepting applications for Lifeguards. This is a part-time on-site role. The Lifeguard will be responsible for maintaining safe swimming conditions in the pool, deck, and surrounding areas. In addition, Lifeguards will be responsible for the safety of all members during the hours of pool operation by being on deck, actively patrolling the pool area, constantly remaining alert and scanning, enforcing all pool rules, and other duties as assigned by their supervisor. Lifeguards must also possess knowledge of rescue procedures and emergency medical procedures. Our YMCA facility features a dynamic Aquatics Center that includes a competitive pool, a recreation pool, a hot tub area, and a state-of-the-art viewing gallery which attracts area swim

Sewell, NJ 08080 • (35.2 miles) • Full Time • 10/10/2026

Benefits:Opportunity for advancementTraining & developmentEmployee discountsFlexible schedule The Lifeguard position is responsible for greeting pool users, pool maintenance, safety and enforcement of pool rules. Must provide written and verbal notification to management of any equipment problems, pool repair needs or safety concerns while removing potential hazards immediately. Must have a pleasing personality to communicate well with members, guests of all ages. Responsible for safety and compliance during special events in aquatics area such as children’s birthday pool parties. Must maintain current Red Cross and CPR Certifications Part time, flexible schedule and compensation to be determined. We value our employees and education to be best in class in fitness. Benefit from our educati

Hatfield, PA 19440 • (36 miles) • Full Time • 10/10/2026

About the role (This is not a starter or training opportunity!Only experienced LV Techs resumes will be considered)We're looking for a skilled, experienced low voltage technician to join our growing team in Hatfield PA. You'll be responsible for the installation, configuration, and service of commercial security camera systems and access control systems. If you're someone who takes pride in clean installs, strong troubleshooting, and delivering reliable security solutions to clients we want to hear from you.ResponsibilitiesInstall and terminate IP and analog CCTV / security camera systemsInstall and program access control systems (card readers, keypads, door hardware)Pull and route low voltage cabling (Cat6, coax, RS485, etc.)Commission and configure NVR / DVR systems and access control so

Delanco, NJ • (16.5 miles) • Full Time • 10/9/2026

Schedule (Open Availability Highly Preferred):6AM-2:30PM Wed,Thurs, Fri, 4AM-12:30PM Sat, SunPay Range:$20 hourlyAbout CarvanaAt Carvana, we believe buying a car the old-fashioned way sucks so we're rewriting the playbook. Yes, we're the vending machine people. Yes, we built that on purpose. And yes, we're just getting started.We're looking for people who want tothrive in an environment of impactful change. Team spirit shows up in everything we do every day, our passion and creativity drive the kind of innovation that moves an industry. We take big swings, set ambitious goals, and challenge each other to make data- and process-driven decisions in everything we do. Here are a few of our stories. We've been changing the game since 2013, and we're not letting up. Want the full story? Check it

Sewell, NJ 08080 • (35.2 miles) • Full Time • 10/9/2026

LOCAL APPLICANTS ONLY PLEASE!Company Overview:Rivell, a leading Managed Services Provider (MSP) based in Sewell, New Jersey, has been recognized as one of Inc. 5000’s “Fastest Growing Companies in America.” We specialize in delivering comprehensive IT and cybersecurity solutions to businesses, local government, school districts, healthcare facilities, and other organizations across a variety of industries.At Rivell, we foster a collaborative and innovative work environment while providing competitive compensation, professional development opportunities, and a clear path for career advancement.Position Overview:We are seeking a Cybersecurity & Compliance Manager to oversee, maintain, and strengthen cybersecurity and regulatory compliance initiatives across our client environments.This role

Pennington, NJ 08534 • (16.7 miles) • Full Time • 10/9/2026

POSITION SUMMARY:Maintains safe swimming conditions in the pool, deck, and surrounding areas. Creates a safe and positive atmosphere that welcomes and respects all individuals and promotes safety in accordance with YMCA policies and procedures. Builds positive relationships with members and program participants through effective listening and verbal skills and creatively finds ways to connect them to one another and the Y community.Shift details:Monday, Tuesday, Wednesday, Friday: 8:45 am - 12:00 pmESSENTIAL FUNCTIONS:Maintains active surveillance of the pool areaKnows and reviews all emergency procedures and responds to emergency situations immediately in accordance with YMCA policies, procedures, and the safe-in-six model; completes related reports as requiredKnows, understands, and cons

Willow Grove, PA 19090 • (25.3 miles) • Full Time • 10/9/2026

Benefits:Retirement plan with matchingUncapped commission structureBonus based on performanceCompetitive salaryDental insuranceFree food & snacksHealth insurancePaid time offVision insuranceAbout Us We are a growing Managed Service Provider (MSP) focused on delivering high-quality IT support, cybersecurity, cloud, backup/disaster recovery, VoIP, and infrastructure solutions to small and mid-sized businesses. We are looking for an experienced B2B technology sales professional to become our primary sales leader and help us grow the next phase of our business. This is not an entry-level sales role. We are looking for someone who already understands how to sell IT services and can independently manage the sales process from prospecting through close. Candidates without prior MSP or managed IT

Neptune City, NJ 07753 • (30.9 miles) • Full Time • 10/9/2026

Aquatic Center LifeguardFor Special Needs Children and AdultsHours: 9:00 to 1:30 Mondays- Fridays. We mostly follow the public school’s calendars.Salary: $18.00 - $23:00/HR.We are both a School and Adult Day Program for children and adults with special needs. We are looking for a certified/licensed Lifeguard for our Aquatic Center on our campus in Neptune NJ. He/she will be responsible for ensuring the safety of our students and adult participants while they are within the indoor pool and the Aquatic Center itself.Duties will include, but not be limited to:Knowledge of water quality and how to test water conditions.Knowledge of general safety guidelines, in and out of the water.Ability to perform life-saving procedures, like CPR, first aid, injury treatment, and water rescue.Effective verb

Philadelphia, PA 19112 • (31.8 miles) • Full Time • 10/9/2026

JOB DESCRIPTION Watershed Security, is a Veteran Owned Small Business with over 20 years’ Cybersecurity and Government Contracting experiencing. Watershed is looking for a Journeyman Information Systems Security Engineer (ISSE) to support the Naval Surface Warfare Center (NSWC) in Philadelphia, PA. The successful candidates will have experience coordinating and enacting required security changes, with in various levels of an organization, ensuring compliance with published policies; conducting cybersecurity vulnerability and threat analysis; and support cyber incident-response by isolating potentially effected assets, initial investigation and data collection, through status updates/reporting. REQUIRED QUALIFICATIONS Bachelor’s degree in Computer Science, IT, or equivalent technical degree

Trenton, NJ • (9.7 miles) • Full Time • 10/8/2026

100% remote. May have to attend an in-person interview after a webcam. Our direct client has an opening for a Security Consultant rec 11350 This position is up to 12 months, with the option of extension, in Columbia, SCPlease send rates and a resume. W2 only, no Subs allowed.5+ years of experience implementing and supporting enterprise security tools (SIEM, CRIBL, XDR, Vulnerability Management, DLP, Endpoint Security)5+ years of experience in supporting large IT environments and/or system deployments5+ years of experience developing automation and integrations using scripting languages such as Python and BASH.Preferred SkillsCISSP or Security+ CertificationsSIEM Administration, Analysis, and Reporting experience.Experience building and deploying Linux-based security sensors.Familiarity wi

Lawrenceville, NJ • (13.7 miles) • Full Time • 10/8/2026

Lifeguard & Support Counselor - NJWho We Are At DEAN Camps, we create life-changing opportunities for young people to discover their passions, explore endless possibilities, achieve meaningful goals, and navigate thrilling adventuresall while developing character and skills that last a lifetime.Guided by our core values of Compassion, Trust, Growth, and Creativity, we foster an environment where learning, discovery, and personal development thrive. Our vision is to inspire generations of resilient, compassionate, and confident individuals who contribute positively to their communities and the world.We operate across DC, MD, NJ, PA, and VA, offering all-inclusive programs that make summer exciting for children and easy for families. Learn more: DEAN Camps.What You’ll Do As a Lifeguard and S

Lakewood, NJ 08701 • (23.6 miles) • Full Time • 10/8/2026

Job Title: Armed Security OfficerCompany: IronRock SecurityLocation: Lakewood NJPay Rate: $25-28/hourPosition Overview: IronRock Security is seeking a reliable and experienced Armed Security Officer with 5+ years of armed security experience to oversee access control at higher education center in Lakewood, NJ. This role requires a strong presence, excellent communication skills, and prior experience with access control. The guard will help ensure site coverage, support fellow officers, and maintain a safe environment for staff and students.Responsibilities:Manage and monitor access control pointsConduct regular patrols of the residential propertyWrite clear incident and daily activity reportsSupport scheduling coordination and communicate staffing needsMaintain a professional and customer-

Philadelphia, PA • (26.9 miles) • Full Time • 10/7/2026

Job SummaryIn this role Physical Security Officers (PSO’s) can expect to be working in demanding and fast paced environments. Physical Security Officers may find themselves working in a wide range of areas to include medical centers, government facilities, hospitality venues and public events. Additionally, Physical Security Officers may be asked to work with a firearm. The PSO's mission is to protect all people, information and property assigned, while delivering on high end customer service. Physical Security Officers represent the front line of our security services.Job Duties / Essential FunctionsDelivering high end customer serviceResponding to emergenciesDeterring and preventing crimePerforming ingress/ egress control proceduresInvestigating incidentsCompleting daily logs and inciden

Trenton, NJ • (9.7 miles) • Full Time • 10/6/2026

This role is tied to a public-sector opportunity with a defined submission deadline. Open the role details to review project status, client/source context, responsibilities, evidence requirements, application steps, and the FuntoNetwork public links before applying. The full role page includes the structured role snapshot and current RFP status context.Role Snapshot Project Status: Green - Open - Accepting ApplicationsDeadline for Submission: October 31, 2026 at 6:00 PM Eastern TimeRate: Estimated 65-139 USD / Hour based on role, experience, and final project requirementsClient / Source: State of New Jersey / NJDOT and agency procurement sourcesDepartment: Cybersecurity, Privacy and RiskReports To: Director of Consulting ServicesLocation: Trenton, NJ, United StatesTravel: As required by pr

Princeton, NJ 08540 • (17.1 miles) • Full Time • 10/6/2026

Job Title: Cloud Security Architect Location: Princeton, NJ(Hybrid) Type: Contract Responsibilities:Lead architecture and implementation of Palo Alto Strata Cloud Manager (SCM)Design secure cloud network architectures across AWS/Azure/GCPDefine standards, best practices, and security frameworks for cloud securityOversee integration of Palo Alto services into enterprise cloud environmentsProvide technical leadership and guidance to engineering teamsCollaborate with stakeholders to align security architecture with business goals Requirements: Strong experience with Palo Alto Networks (SCM implementation required)Proven experience in cloud security architecture (AWS/Azure/GCP)Deep understanding of network security, firewalls, and cloud integrationsExperience leading design and architecture de

Princeton, NJ • (16.6 miles) • Full Time • 10/5/2026

SciTec, a wholly owned subsidiary of Firefly Aerospace, is a dynamic non-traditional defense contractor that delivers advanced technologies in support of U.S. National Security and Defense. For the past forty-five plus years, we have supported Department of Defense customers by developing innovative remote sensing algorithms, tools, and techniques to deliver world-class data exploitation capabilities supporting missile defense; intelligence, surveillance, & reconnaissance; space domain awareness; and aircraft survivability missions.Important Notice: SciTec exclusively works on U.S. government contracts that require U.S. citizenship for all employees. Applicants that do not meet this requirement will not be considered.SciTec has an immediate opportunity for a talented engineer to support ou

Philadelphia, PA • (26.9 miles) • Full Time • 10/5/2026

Role: Security Monitoring Associate, Part TimeLocation: Philadelphia, PAPart TimeWe are Growers, We are Wholesalers, We are Producers, We Are Budtenders, We are Retailers, We are Partners, and We are HiringYour Impact: Watch our security cameras during the day to help keep the team, our stores and facilities, and products safe. Watch for anything unusual or out of place and communicate concerns effectively.Welcome and check in visitors using our iPad system and make sure all doors are secure. Ensuring that all visitors are authorized to be in the building.Keep logs up to date including scanned IDs, visitor sign-ins, and daily security notes.Notify management of issues with cameras, alarms, or internet connectivity. whether it's a technical issue with the cameras or suspicious activity repo

Philadelphia, PA • (26.9 miles) • Full Time • 10/5/2026

Security Risk Advisors Intl., LLC (SRA) is offering a Cloud Security Engineer position. This roleis responsible fordesigning, implementing, andmaintainingsecurity controls across SRA's multi-cloud environment, spanning Microsoft Azure/Entra ID, Google Cloud Platform (GCP), and Amazon Web Services (AWS). The Cloud Security Engineer will work closely with internal IT, security operations, and engineering teams to ensure cloud infrastructure is deployed andmaintainedin a secure, compliant, and resilient manner.Essential FunctionsDesign, implement, andmaintaincloud security architectures across Azure/Entra ID, GCP, and AWS environments.Administer and continuously improve cloud identity and access management (IAM) policies, roles, and privilege models across all three platforms.Monitor cloud en

Trenton, NJ 8601 • (9.7 miles) • Full Time • 10/5/2026

We are looking for a Technical Account Manager to manage and grow existing commercial accounts within electronic security, with a primary focus on access control.This is a relationship driven role, but it requires real technical depth. You need to understand how access control systems work, be comfortable discussing system architecture and customer requirements, and be able to recognize where an existing customer has opportunities for upgrades, expansions, service, and additional technology.What You'll Do• Manage and grow an existing portfolio of enterprise security accounts• Develop relationships with customers and identify opportunities to expand their access control environments• Conduct customer meetings and site visits to understand current systems, pain points, upcoming projects, and