Houston, TX • (21 miles) • Full Time • 10/15/2026

DescriptionThe Law Office of Bryan Fagan is seeking a "battle-tested" advocate to join our powerhouse platform. This unique role is designed for a high-performing attorney who thrives in the courtroom and possesses a dual mastery of Probate, Estate Planning, Probate and Guardianship department.At our firm, we have cleared the path so you can focus on the practice of law at the highest level. You will not be responsible for lead generation, business development, or chasing invoices; instead, you will lead high-impact cases with the full support of our dedicated marketing, administrative, and billing engines. This position requires a mobile and versatile advocate ready to represent clients across all Law Office of Bryan Fagan locations and surrounding Texas courts.Key ResponsibilitiesYour ro

Pearland, TX 77581 • (30.3 miles) • Full Time • 10/15/2026

DATA CENTER ALARM CONSTRUCTION TECHNICIAN - TRAVEL REQUIREDSummary: The Data Center Alarm Technician is responsible for the installation, testing, troubleshooting, and service of fire alarm and life safety systems supporting large-scale data center projects. This role will work directly on critical infrastructure where system reliability, attention to detail, and adherence to safety and code requirements are essential.The ideal candidate will have strong experience with fire alarm systems, the ability to read and interpret plans and wiring diagrams, and hands-on experience with installation, programming, testing, and troubleshooting. Candidates should be comfortable working in active construction environments and traveling to multiple jobsite locations as project needs change.Job Responsib

Houston, TX • (21 miles) • Full Time • 10/14/2026

Are you an experienced Alarm Installer/AV Technician looking for a great opportunity? Join a company that values your skills and offers steady, rewarding work! This role focuses oncustomresidentialhomes. Ready to take the next step in your career? Apply today and join a team that values your expertise!Responsibilities:Install access door hardware (some wire pulling involved).Read and interpret plans and blueprints with confidence.Work independently while collaborating with a supportive team.Troubleshoot complex system issues and implement effective solutions.Build strong relationships with customers by providing efficient and reliable service.Conduct site surveys to assess installation requirements.Stay up to date with training and team meetings.Take on additional tasks as needed.Requirem

Houston, TX 77064 • (16.6 miles) • Full Time • 10/14/2026

Security TechnicianHouston, TXReports to Operations TeamCore Values:Be Respectful, Be Accountable, Be ExceptionalWe Offer:- Competitive pay- Great benefits package- Excellent growth opportunitiesLocation: Houston, TXPosition Summary: This is a great opportunity for applicants with strong security installation and service skills who want to provide excellent customer satisfaction services. Security Technicians install and service Access Control Systems, Video Systems, Visitor Management, and more.Job Requirements· Responsible for basic and advanced electronics installation and/or servicing of all required systems. This includes troubleshooting and recommending repair options with follow through of the repairs.· Submit complete and accurate paperwork in a timely manner obtaining the proper s

Houston, TX • (21 miles) • Full Time • 10/14/2026

The Senior Project Manager for Commercial Fire Alarm and Security Installs will oversee medium-sized project teams, typically consisting of 6-15 members, ensuring the successful delivery of installation projects for fire alarm and security systems. Reporting to Senior Management, this role requires frequent travel to job sites to maintain direct oversight and client engagement. The ideal candidate will combine strong project management skills with industry-specific knowledge to coordinate teams, manage budgets, and uphold safety and quality standards.ResponsibilitiesPlan and schedule project activities to ensure timely completionCoordinate and lead project teams to achieve objectivesMaintain effective communication with clients and stakeholdersManage project budgets and control costsEnsure

Houston, TX • (21 miles) • Full Time • 10/14/2026

Job Summary: This position is responsible for the installation and activation of monitored security systems through the Company. Is responsible for trouble shooting and repairing these systems when needed. It also helps with other low voltage/AV/network installations of products purchased by the customer.Responsibilities:Basic alarm panel programming.· Basic networking knowledge from router set up, terminating all fittings (Cat 5, Cat 6, R66, BNC, etc.) and inserts.· Speaker installs and volume controls.· Able to find cables or tone cables in walls.· Assists with television hangs.· Able to install WI-FI packages.· Activations for Alarm.com and Total Connect.· Able to install cameras and DVRs.· Knowledge of security panels.· Television hangs without help.· Able to hook up audio/amps.· Proje

Houston, TX 77073 • (26.7 miles) • Full Time • 10/14/2026

HSSE AdvisorMake An Impact With USThe HSSE Advisor will be a business representative for health, safety, security and environmental (HSSE) programs, ensuring compliance with Vallourec policies and standards, maintaining compliance with ISO Certification standards, and all local, state, and federal regulations. An HSSE Advisor is responsible for promoting a proactive HSSE culture and driving a continuous improvement-based HSSE management system. An HSSE Advisor will collaboration across business departments to align/standardize health, safety, security and environmental programs. An HSSE Advisor is responsible to support development of World Best in Class programs in HSSE Leadership, Management Systems and Culture to deliver on Vallourec’s ambitions for 2030 and beyond.Your Role at a Glance

Houston, TX • (21 miles) • Full Time • 10/14/2026

Med Security is seeking disciplined and proactive Armed Security Supervisors to serve as the operational anchor for our Houston territory. This position is the primary "bridge" between morning and evening shifts and serves as the second-in-command to the Account Manager. The successful candidates will manage field personnel and will assist the Account Manager during their scheduled shifts in handling high-level client needs, emergency staffing decisions, and administrative oversight.Shift Availability (Position requires a clean driving record and a valid Drivers License):Sat and Sunday(Weekend) from 12pm - 8pmMonday through Friday from 12pm to 8pmMonday through Friday from 4pm to midnightKey Responsibilities:Executive Support: Act as the designated representative for the Account Manager in

Houston, TX • (21 miles) • Full Time • 10/13/2026

Exciting Security / Soc Analyst III, 6 months contract opportunity in Houston, TX.Requirements5 plus years experience in the security domain, Incident Response, threat monitoring, and handling incidents (incident triage and response)Determine detection requirements for data sources being on-boarded to the SIEM, and assessing the value of in place SIEM detection cases, in order to determine gaps and overlap in the overall detection scheme.Perform security monitoring and incident response of cyber security events for proper determination of being considered a cybersecurity event.Triage offenses for false positivesHands-on experience defining detection or protection schemes based on industry standards and frameworks.SIEM, Endpoint Detection and Response, Firewall/IPS/IDS, Proxy, Data Loss Pre

Houston, TX 77032-2943 • (21 miles) • Full Time • 10/13/2026

Job OverviewFirst Call Security Innovations LLC is seeking dependable, hands-on independent contractors to assist with commercial security and technology installation projects.This role primarily involves pulling and routing cable, mounting cameras and security devices, and completing physical installation work at commercial, institutional, and construction job sites.The ideal contractor has hands-on construction or installation experience, is comfortable using tools, and can complete assigned work safely, efficiently, and with attention to detail.Scope of WorkPull, route, and secure low-voltage cable through ceilings, walls, conduit, and cable pathways.Install cable supports, J-hooks, and cable management materials.Mount security cameras, access control readers, and other electronic secur

Houston, TX 77001 • (31 miles) • Full Time • 10/13/2026

Microsoft 365 Data Security ConsultantLocation: Downtown Houston, TX onsite Monday–Friday Employment: Contract | Immediate start We are looking for a consultant to help strengthen data security across Microsoft 365. The work includes implementing Microsoft Purview controls, improving DLP policies, and supporting identity and access security. ResponsibilitiesReview existing data protection controls and recommend improvements.Configure sensitivity labels, data classification, encryption, and automated labeling.Implement and fine-tune DLP policies for Microsoft 365 applications and employee devices.Review alerts, resolve policy issues, and reduce unnecessary notifications.Assist with Entra ID access controls, permissions, and access reviews.Maintain clear documentation and coordinate with sec

Houston, TX 77040 • (15.3 miles) • Full Time • 10/12/2026

Description: Objective:Installation Helper to assist in the installation, maintenance, and servicing of fire alarm systems. The ideal candidate will have a basic understanding of electrical systems, excellent attention to detail, and a strong willingness to learn and grow within the field. This role provides hands-on experience in the fire safety industry while working alongside experienced technicians.ResponsibilitiesAssist in the installation and maintenance of low voltage systems.Help troubleshoot and repair low voltage systems and components.Work with the technician to test and inspect low voltage systems for proper operation.Support the setup and wiring of low voltage equipment, including control panels, and devices.Handle tools, equipment, and materials related to low voltage systems

Houston, TX • (21 miles) • Full Time • 10/12/2026

Salary: $100,000-$110,000Location: Houston, HybridCybersecurity AnalystWe are seeking a Cybersecurity Analyst to join a growing IT security team and help protect the organization’s systems, data, and technology environment. This role will focus heavily on security monitoring, threat detection, investigation, and incident response.The ideal candidate has hands-on cybersecurity experience and can independently recognize suspicious activity, investigate potential threats, determine the appropriate response, and escalate when necessary.Key Responsibilities:Monitor and investigate security alerts across endpoints, identity, email, cloud, and network environmentsIdentify, triage, and respond to potential cybersecurity threats and suspicious activityManage and work through SOC/security tickets fr

Houston, TX 77058 • (40.7 miles) • Full Time • 10/12/2026

Title: Cybersecurity SpecialistLocation: Houston, TXWho we are:Voted one of the Nation's Best and Brightest Companies to Work for, Kuraray America, Inc. (KAI) is a global leader in specialty chemical, fiber, and resin production. With top-of-the-line research and production facilities and a vast network of supplies from around the world, Kuraray leads the industry in specialty dental, fiber, resin, and elastomer products. Kuraray America is a wholly owned subsidiary of Kuraray Company, Ltd. Based in Tokyo, Japan. Kuraray has operations in 31 countries and employs more than 11,000 employees, including over 800 in the United States.Why Kuraray:Kuraray is building a better tomorrow, today. Our team members are dedicated to expanding our business with committed professionals who share essentia

Tomball, TX 77375 • (25.5 miles) • Full Time • 10/11/2026

About Us We’re a growing Managed Services Provider (MSP) dedicated to supporting credit unions with their IT and cybersecurity needs. Our mission is simple: keep our clients’ technology secure, reliable, and running smoothly so they can focus on serving their members. We value teamwork, curiosity, and innovation, and we believe that doing great work should also be fun. If you’re eager to build your cybersecurity career in a supportive, fast-growing environment, you’ll feel right at home here.The Position: The Security Analyst is an entry-level cybersecurity professional responsible for monitoring, analyzing, and supporting our client's organization’s security. This role focuses on operational security and works closely with outsourced Security Operations Centers (SOCs), internal Informatio

Houston, TX 77001 • (31 miles) • Full Time • 10/11/2026

Description: Join a company where your reliability and craftsmanship are valued. State Fire is seeking an experienced, licensed Fire Alarm Technician to join our growing team in the Houston, TX region. As a regional leader in fire protection, we specialize in the installation, service, and maintenance of fire alarm systems, alarm monitoring, special hazard suppression systems, fire sprinklers, security systems, and more.We’re looking for a dependable professional who takes pride in doing the job right, someone with strong technical ability, a solid work ethic, and a commitment to quality and safety. If you want to build a long-term career with a company that values expertise and reliability, we want to hear from you.What You’ll Do Install, inspect, service, and maintain a variety of fire a

Pasadena, TX 77506 • (32.9 miles) • Full Time • 10/11/2026

Duties: The Lifeguard Instructor is responsible for the instruction, leadership, supervision, control, and safety of all class participants. The lifeguard instructor is responsible for the appearance, presentation, and working order of all materials and equipment used for lifeguard instruction. It is the lifeguard instructor's responsibility to observe and direct all class participants, and to provide feedback and appropriate correction as instructed or included in the job description. The Lifeguard Instructor position is a year-round part-time position with the City of Pasadena Parks & Recreation Department that cannot work more than 999 hours per calendar year. Plans and organizes personal class teaching outlines, methods and goals that support the general teaching outlines provided by t

Katy, TX • (6.6 miles) • Full Time • 10/9/2026

GPI Defense is seeking dependable security officers for assignments in the area of Katy. We are looking for Officers who already have their commissioned (lvl 3/armed) security license for Texas.Children's Sport Event.Armed Positions: KatyEvent on 10/17 and 10/18 from 0730-2000Responsibilities (may include)Control entry and exit at the assigned access pointPrevent unauthorized public accessWatch for unauthorized removal of merchandise or propertyDocument and report incidents or concernsMaintain a professional and attentive presenceRequirementsValid Texas security licenseReliable transportationProfessional appearance and conductStrong communication skillsDependability and punctualityAbility to follow established site procedures*Pay rate is determined after interview depending upon persons ex

Houston, TX 77027 • (17.5 miles) • Full Time • 10/9/2026

OverviewOur team is on a mission to create a safe, fun, and encouraging environment where kids not only learn to swimthey thrive! As a Lifeguard, you’ll play a vital role in ensuring every swimmer enjoys a safe and positive experience. You’ll stay alert, protect lives, and help foster a welcoming environment for our students and families.We’ve earned top employer awards nationwide, and it’s all thanks to dedicated team members. Ready to make a splash?Why You'll Love It Here:Make a Real Impact – You’re the first line of safety, ensuring swimmers of all ages can learn and play with confidence.Growth Opportunities – There are more opportunities beyond lifeguarding such as becoming a swim instructor or mentor.Join a Supportive Team – Work alongside fun, motivated teammates who care about safet

Channelview, TX 77530 • (37.6 miles) • Full Time • 10/9/2026

Benefits:401(k)401(k) matchingCompetitive salaryDental insuranceFree uniformsHealth insuranceOpportunity for advancementPaid time offTraining & developmentVision insurancePosition Summary:This role is not a security guard position. The standard function of the position is to build, program, deploy, and service our Mobile Security Trailers (MSTs). The position requires that the candidate is able to adjust to a fast-paced market where last-minute movements happen often. The candidate will need to be able to work with minimal supervision and provide great customer service. Duties And ResponsibilitiesInstall and service CCTV, batteries, solar panels, and solar controls.Maintain and service small engine gas powered generators.Must have a strong work ethic and ability to work well with other tea

Houston, TX • (21 miles) • Full Time • 10/9/2026

This role may be based in New York City, Washington DC, Chicago, Houston, the San Francisco Bay Area, or Los Angeles.Control Risks is seeking a Physical Security Designer to support the growth of its Built Environment & Infrastructure design practice in North America.The role will prepare and review design drawings, technical documentation, specifications, schedules, reports, and related files for electronic and non-electronic physical protection systems. This includes support to facility upgrades, new construction projects, and multidisciplinary design and delivery processes.The successful candidate will bring practical knowledge of security design, construction documentation, building and life safety codes, industry standards, and related guidelines, working as part of the US-based Ameri

Houston, TX 77098 • (19.3 miles) • Full Time • 10/9/2026

At Sunflower Bank, N.A., we’re experiencing great growth. Since our founding in 1892, we've been committed to serving our communities and supporting the team members who make it all possible. As a full-service financial institution, we offer a full range of relationship-focused services to meet personal, business, and wealth-management financial objectives. Creating Possibility is not just our mission, it’s what we do every day for clients and associates. Learn more about Sunflower Bank, N.A. at sunflowerbank.com.Sunflower Bank, N.A. is looking for an energetic, highly motivated individual to fill the position of a full-time Fraud Analytics & Loss Prevention Assistant Manager.This position is under consideration to work fully remote. – can add if this statement is trueDescription:The Fraud

Conroe, TX 77301 • (42.8 miles) • Full Time • 10/9/2026

JOB SUMMARYThe Lifeguard is responsible for the safety of patrons in the pool(s) and surrounding environments. Act as first responder in emergency situations. Provide customer service to all members, participants and guests. Follow and enforce all City of Conroe and Center policies and procedures. Participate in all in-service training sessions. Conduct various pool maintenance duties, including testing water chemistry and checking mechanical system operation. Complete all required records and reports.QUALIFICATIONSEducation and Experience:Minimum age of 15. Must be pursuing high school diploma or equivalent. Must possess current American Red Cross Certifications in Lifeguarding and CPR for the Professional Rescuer.Knowledge, Skills and Abilities: Knowledge of and up to date on all require

Houston, TX 77066 • (20.2 miles) • Full Time • 10/8/2026

Job Summary:The Fire Alarm Technicianis responsible forthe installation, testing, inspection, service, and repair of fire alarm systems. Respond to emergency and maintenance calls and troubleshoot/replace faulty devices to restore alarm panels to “normal condition”.Complete inspection and service reports.Supervisory Responsibilities:NoneEssential Job Functions:Traveltocustomerlocationstoperforminstallation,service,andupgradesoffirealarmsystems.Respondtoemergencysituationsduringandafterbusinesshourstoresolvesafetyconcerns.PerformAnnualandSemi-annualinspectionofLifeSafetySystems.Write and provide inspection/service reports on tested equipment and devices.Indicate any deficiencies or corrections that need tobemade.Troubleshootanddiagnosefaultsormalfunctionsinfirealarmsystemsandtakeappropriate

Houston, TX 77093 • (25 miles) • Full Time • 10/8/2026

Why Pref-Tech?Voted "Top Workplaces" by Houston Chronicle and Austin American Statesman, 2 years in a row! We aim to make “family” a core reason we attract incredible people, retain them, and collectively deliver unequaled quality and service to customers. If your heart and mind are pushing you to join a team who deeply desires to be the best in the world, has a long-game approach to business, prides itself on doing exceptional work, celebrates service to others, and is willing to invest in you, you should consider Pref-Tech.Position Overview: This role is in Corpus Christi. The Security Technician 1 at Pref-Tech will be responsible for assisting in installing access control, IP-based and analog video management systems, intrusion systems, and auto-gate equipment. Scope of duties include,

Houston, TX 77002 • (22.3 miles) • Full Time • 10/8/2026

Description: We are ERock!ERock is a leader and innovator in distributed energy. ERock has responded to long-term trends in electricity by becoming the first smart-grid supplier to US energy consumers. The company installs, operates, and integrates its highly flexible, low-cost, and quick-response distributed generation to increase reliability and stability, reduce costs and decrease carbon footprint.At ERock, our backup generators ensure that customers will never be without power, allowing their business to operate normally when there is an outage in the area. Our innovative approach provides customers with highly reliable, ultra-clean backup generation at a fraction of the cost of traditional backup solutions. We seek those who share our commitment to customer service, innovation, and in

Houston, TX 77019 • (19.5 miles) • Full Time • 10/7/2026

The Noble 33 Hospitality and lifestyle company is seekingaSECURITY HOST- Toca Madera HoustonToca Madera re-imagines traditional Mexican cuisine by taking a modern approach pairing locally-sourced ingredients with bold flavors. Our menu is designed to offer an array of options for every eater. Our signature farm-to-glass cocktails use only fresh, seasonal ingredients and our dynamic bar program offers a vast selection of the finest tequilas and mezcals, as well as a rotating selection of wines from across the globe. At Toca Madera, we've thoughtfully curated all the elements of the restaurant to elicit an unmatched sensory experience. From our visually stunning design and seductive music to our award-winning menu, let Toca Madera transport you to a world that’s both modern and timeless.As a

Houston, TX 77021 • (23 miles) • Full Time • 10/7/2026

Benefits/PerksCareer Advancement OpportunitiesCompetitive CompensationFlexible ScheduleJob SummaryWe are seeking a professional Security Guard to join our team. In this role, your primary responsibility will be to create a safe and secure environment. You will protect our premises, assets, and employees and prevent any illegal or inappropriate occurrences. The ideal candidate has experience with public safety and security and operates with a high degree of integrity at all times.ResponsibilitiesPatrol the premises and maintain a high level of visibilityMonitor entrances and exits to ensure only authorized personnel access the facilityRemove trespassers when necessaryMonitor surveillance camerasRespond to reports of suspicious activityReport on daily activities and any security incidentsQua

Houston, TX 77077 • (5.7 miles) • Full Time • 10/7/2026

Overview Allied Universal®, North America’s leading security and facility services company, offers rewarding careers that provide you a sense of purpose. While working in a dynamic, welcoming, and collaborative workplace, you will be part of a team that contributes to a culture that positively impacts the communities and customers we serve. Job Description As a Security Guard Armed Patrol Driver Level III in Houston, TX, you will serve and safeguard clients in a range of industries such as Retail/Malls, and more. Join a leading team where flexibility meets opportunity. As a Part-Time Security Officer, you can build a schedule that works for you and explore new roles using our Claim a Shift platform. Learn more: aus.com/earnmore. As an Armed Patrol Officer at a retail location, you will con

Katy, TX • (6.6 miles) • Full Time • 10/6/2026

Location:Overseas, Camp Bondsteel Pristina, KosovoBenefits:First-Year Completion BonusTravel AllowanceAnnual PTO Allowance Continuity Global Solutions CGS - Kosovo, LLC (CGS - Kosovo) is advertising in your community for an exciting opportunity to work overseas on a U.S. Government contract in the Eastern European Country of Kosovo -in the city of Pristina.Whether you are just looking for a job in an exciting location with opportunities for growth or simply want to get your foot in the door in Government contracting where we could help you gain or maintain a security clearance – this opportunity is for you!Summary:The Armed Security Guard provides security, installation access control, roving patrols, surveillance, monitoring and overall safeguarding to the installation and its tenants. Th

Houston, TX 77064 • (16.6 miles) • Full Time • 10/6/2026

Locations: Houston (8718) Business Units: Central About the Job: Full Time Job FunctionThe Senior IT Security Analyst is responsible for safeguarding enterprise systems, networks, and data across both corporate and manufacturing environments. This role has a strong focus on Splunk administration, security monitoring, threat detection, and incident response, serving as a key contributor to the organization's Security Operations capabilities. The analyst will leverage SIEM technologies, security analytics, and log management practices to proactively identify and respond to cybersecurity threats while supporting compliance and security initiatives across IT and operational technology (OT) environments.This position partners closely with IT Infrastructure, Operations, OT, and business teams to

Houston, TX • (21 miles) • Full Time • 10/6/2026

Armed Security Officer Houston, TX (North Cypress Area)Protect. Mentor. Lead.Serve with Purpose.Houston, TexasAt Tier One, we believe every person deserves to feel safe where they work, receive medical care, worship, or do business. As an Armed Security Officer, you'll be more than a uniform the calm professional who brings confidence during uncertainty, the trusted presence people rely on, and the first line of defense when safety matters most.If you've worn a badge, served in the military, worked in security, or simply feel called to protect others, you already understand that real security is about earning trust not just carrying a firearm.About the AssignmentThis position supports a healthcare and community-safety environment at a major medical campus in the Houston area. Officers assi

Alvin, TX 77511 • (39 miles) • Full Time • 10/6/2026

Job Announcement: Under general supervision your primary responsibility is to ensure the safety of individuals in and around the aquatic facility. You will be tasked with preventing and responding to emergencies, enforcing facility rules, and providing excellent customer service. This role requires strong swimming skills, quick decision-making abilities, and effective communication.Minimum Qualifications:Applicants must be able to work morning shifts.Current Red cross lifeguard certification or the ability to obtain prior to starting work.Recognized lifeguard training program other than Rec Cross may be substituted.Basic first aid and CPR certification.Salary: Starting Salary: $10.20Job Posted by ApplicantPro

Houston, TX 77042 • (10.6 miles) • Full Time • 10/5/2026

SwimJim Texas is a year-round, indoor, heated facility looking to interview future SwimJim super hero lifeguards and swim coaches! We are looking for individuals who can add to our already fun and dynamic team. We are a team consisting of individuals who genuinely enjoy working with one another and have great work ethic and believe in making every day, a positive one!Our mission is to help prevent drowning in a Happier, Healthier and Safer method.We are looking for excited individuals who understand the importance of water safety and keeping swimmers safe. We are looking for individuals who take pride in their duties and responsibilities as lifeguards and swim instructors. All swim instructor training is done in-house. Give us the opportunity to train you with the tools necessary to become

Houston, TX 77001 • (31 miles) • Full Time • 10/5/2026

Zona Facta CollectivePosition: Level III ATM Protection AgentLocation: Houston, TX (Hybrid)Department: OperationsCompensation: $20.00/hour | Weekly Direct DepositEmployment Type: 1099 Independent ContractorJob OverviewZona Facta Collective is currently seeking qualified Level III Armed Security Agents for multiple security contracts across Texas. We have an immediate need for our ATM Technician Security Contract in the Greater Houston area. Agents will be responsible for escorting ATM technicians to ensure they can perform their tasks safely and without disruption.Key ResponsibilitiesEscort ATM technicians to and from job sites across the Greater Houston area.Ensure the safety of technicians during all assigned shifts.Remain on standby, ready to deploy at the start of each scheduled shift.

Houston, TX 77015 • (33.9 miles) • Full Time • 10/5/2026

*** THIS ANNOUNCEMENT MAY SERVE AS A CONTINUOUS ANNOUNCEMENT FOR ADDITIONAL VACANCIES FOR BOTH DAY AND NIGHT SHIFTS ***OverviewWe are seeking an Armed Security Specialist III to become an integral part of our team. In this position, you will be tasked to provide physical security, physical security inspections and entry access control at designated locations.A position with SENTRYSIX International is more than just a job, it’s the start of a great career. Joining the SENTRYSIX team means that you are joining an operational support and threat management provider to government and commercial clients worldwide. Because of this, we search for individuals of the highest caliber and experience.Veteran owned & operated company – Are you a Veteran? – We want to hear from you! APPLY TODAY!Responsib

Houston, TX 77058 • (40.7 miles) • Full Time • 10/5/2026

Patriot Maritime are maritime government contracting companies providing management, crewing, and vessel support services to the U.S. government under contracts with MARAD and the Military Sealift Command (MSC). With approximately 83 shoreside employees and operations across multiple vessel programs including the Ready Reserve Force (RRF), Watson-class vessels, Bob Hope vessels, and other federal maritime programs Patriot operates at the intersection of commercial maritime expertise and federal government contracting. Headquartered in Houston, TX, our team supports the nation’s strategic sealift mission and military readiness.Patriot is seeking an experienced Cybersecurity Analyst / Engineer to build, operate, and mature the organization's information security program. The complexity of Pa

Houston, TX 77024 • (13.8 miles) • Full Time • 10/3/2026

Quanex is looking for aCybersecurity Manager in Houston, TX or Akron, OH.The Cybersecurity Manager will be responsible for oversight, monitoring, and alerting all aspects of the Quanex cybersecurity environment. This position will have direct reports and will be responsible for the cybersecurity program of the business.We Offer You!Competitive Salary401K Match w/ 2-year vesting periodBonus PotentialMedical, Dental & Vision PlansPaid Time Off & HolidaysVarious Work SchedulesTuition AssistanceWellness/Fitness ResourcesTraining/DevelopmentEmployee Stock Purchase PlanDynamic Culture & People - just to name a few!What’s attractive about the Cybersecurity Manager position?Lead and strengthen Quanex’s enterprise cybersecurity program, helping protect critical systems, data, and global operations.

Houston, TX • (21 miles) • Full Time • 10/3/2026

Company OverviewAsset Living is a third-party management firm and a proven partner in fostering thriving communities nationwide. Founded in 1986, Asset Living has decades of experience delivering exceptional value to our partners. Since the beginning, our undeniable passion has driven our organic growth from a small property management firm to one of the most trusted allies in real estate. Asset Living's growing portfolio includes a multitude of properties across the country that span the multifamily, single-family home rentals, affordable housing, build-to-rent, active adult, and student housing divisions.Asset Living is a fast-growing company made up of talented individuals from diverse backgrounds that differentiate us and help us drive innovation and results for our clients and communi

Houston, TX 77024 • (13.8 miles) • Full Time • 10/2/2026

Company Description About Solaris Energy Infrastructure Solaris Energy Infrastructure, Inc. (NYSE:SEI) provides scalable equipment-based solutions for use in distributed power generation as well as the management of raw materials used in the completion of oil and natural gas wells. Headquartered in Houston, Texas, Solaris serves multiple U.S. end markets, including energy, data centers, and other commercial and industrial sectors.Job Description About the OpportunitySolaris is building out networked power generation and distribution assets across multiple customer sites. Site networks reach down to turbine and balance-of-plant equipment, SCADA runs on Ignition, and protection and control includes SEL devices connected over SEL software-defined networking.This environment is being designed

Houston, TX 77002 • (22.3 miles) • Full Time • 10/2/2026

The Loss Prevention Officer will be instrumental in creating a safe, secure, and welcoming environment for guests and staff. By proactively patrolling the property, responding to incidents, and assisting in emergencies, you will help maintain the integrity of the hotel’s operations and guest experience. Your role ensures that every individual on the premises feels protected and that the property remains compliant with regulations and internal policies.HOW YOU’LL SHAPE THE EXPERIENCE & FUTUREPatrol lobbies, corridors, and public rooms, confer with management, interview guests and employees and interrogates persons to detect infringements, investigate disturbances, complaints, thefts, vandalism, etc.Patrol public areas to detect fires, unsafe conditions and damaged or inoperative safety equi