Houston, TX • (44.9 miles) • Full Time • 9/15/2026

The Senior Project Manager for Commercial Fire Alarm and Security Installs will oversee medium-sized project teams, typically consisting of 6-15 members, ensuring the successful delivery of installation projects for fire alarm and security systems. Reporting to Senior Management, this role requires frequent travel to job sites to maintain direct oversight and client engagement. The ideal candidate will combine strong project management skills with industry-specific knowledge to coordinate teams, manage budgets, and uphold safety and quality standards.ResponsibilitiesPlan and schedule project activities to ensure timely completionCoordinate and lead project teams to achieve objectivesMaintain effective communication with clients and stakeholdersManage project budgets and control costsEnsure

Humble, TX 77338 • (31.6 miles) • Full Time • 9/30/2026

For the past 80+ years, M&Dhas led the aftermarket in remanufacturing innovation to address technological advancements and changing customer needs. In the past few decades, we have expanded beyond our remanufacturing roots to develop close (and sometimes exclusive) partnerships with the world’s leading OEMs and manufacturers.Those partnerships with key suppliers like Bosch, Garrett, Federal Mogul, Cummins, Stanadyne, Holset, BorgWarner, Delphi, Yanmar, Mitsubishi, Denso and others have been critical in honing our remanufacturing capabilities and expanding our parts offering to include new, no core options in fuel injectors and fuel pumps, diesel engine cylinder heads, blocks, crankshafts and connecting rods. M&D also stocks a complete assortment of turbos (new and remanufactured), inframe

Houston, TX • (44.9 miles) • Full Time • 9/30/2026

Are you passionate about protecting organizations from cyber threats and helping shape the future of cybersecurity? Virtuo Group is seeking a skilled and motivated Cybersecurity Analyst to join our award-winning team. In this role, you’ll monitor, detect, and respond to security incidents, while working alongside experts who are dedicated to keeping our clients’ systems secure. If you thrive in a fast-paced, dynamic environment and enjoy solving complex challenges, this is the opportunity to make a real impact.Workdays & Hours: MONDAY – FRIDAY 8:00 AM – 5:00 PM* *Subject to Change / Remote is Not an OptionDESCRIPTION OF DUTIES / ESSENTIAL FUNCTIONSDuties, functions and responsibilities of this position include:Responsible for communicating cyber risks and recommendations to mitigate risks

Conroe, TX 77301 • (9 miles) • Full Time • 9/30/2026

JOB SUMMARYThe Lifeguard is responsible for the safety of patrons in the pool(s) and surrounding environments. Act as first responder in emergency situations. Provide customer service to all members, participants and guests. Follow and enforce all City of Conroe and Center policies and procedures. Participate in all in-service training sessions. Conduct various pool maintenance duties, including testing water chemistry and checking mechanical system operation. Complete all required records and reports.QUALIFICATIONSEducation and Experience:Minimum age of 15. Must be pursuing high school diploma or equivalent. Must possess current American Red Cross Certifications in Lifeguarding and CPR for the Professional Rescuer.Knowledge, Skills and Abilities: Knowledge of and up to date on all require

Houston, TX 77064 • (35.3 miles) • Full Time • 9/30/2026

SUMMARY - The purpose of this position is to support the Security Manager through reports, data collection and data entry, compliance and audit documentation, budget and purchase administration, records control, and internal/external liaison. This is an administrative and analytical support role focused on documentation, coordination, tracking, and escalation in support of security operations. JOB RESPONSIBILITIES AND ACTIVITIES - Complete assigned recurring and ad-hoc security reports, including weekly NPI metrics, training completion, audit status, task closure, visit logs, and other site/HQ templates.Collect source data from function owners, post logs, training systems, audit trackers, and on-site files; enter, clean, and update data in designated trackers and templates.Maintain data ac

Houston, TX • (44.9 miles) • Full Time • 9/30/2026

ResponsibilitiesDevelop plans to safeguard computer files against unauthorized modification, destruction, or disclosure.Choose, implement, monitor, and upgrade computer anti-virus and malware protection systems.Encrypt data transmissions and erect firewalls to conceal confidential information during transmission.Implement password authentication to keep unauthorized users from accessing sensitive data files.Modify security files to incorporate new software, correct errors, and change user access status.Perform risk assessments and tests on running data processing activities and security measures.Educate workers about computer security and promote security awareness and security protocols.Keep accurate and current backup files of all important data on the shared corporate network.IT securit

Houston, TX • (44.9 miles) • Full Time • 9/29/2026

Job Title: Security, Surveillance, and Access Control Installation & Service TechnicianExperience: Minimum 3 years in security, surveillance, and access controlStarting Pay: $26-$36/hour (DOE) + Bonus PotentialAt BCS, we value your skills, dedication, and ambition. As a locally owned company in Evansville, IN, we offer a tight-knit, collaborative environment with real growth, skill development, and clear paths for advancement. But joining our team isn't just about a great new role, it’s your opportunity to build a high-quality, affordable life in a booming Midwest hub along the scenic Ohio River.Unbeatable Cost of Living: Your paycheck stretches further here. Enjoy remarkably affordable housingfrom historic downtown lofts to spacious suburban homeswithout sacrificing quality of life.Thrivi

Houston, TX • (44.9 miles) • Full Time • 9/29/2026

AXG is partnered with an independent power generation company is seeking a Cybersecurity Vulnerability Management Lead to own its vulnerability and patch management program across corporate IT and power generation OT environments. This is a hands-on role for someone who can turn findings into completed remediation while protecting the safety and availability of operating plants.Reporting to the Cybersecurity Manager, you will work with infrastructure, network, cloud, application, security, and OT/SCADA teams. The position may be based in either Houston or the New York Metropolitan Area and involves collaboration with generating sites.Responsibilities:Own the vulnerability lifecycle: assess and validate findings, prioritize them by exploitability and asset criticality, assign accountable ow

Houston, TX • (44.9 miles) • Full Time • 9/29/2026

Join Our Security Team!Are you looking for a stable, rewarding job with growth opportunities? We’re hiring dedicated security professionals! Here’s what we offer:Please submit your resume and candidates can be contacted upon interview availability.What We Offer:- Set Schedules.- All Shifts – Day, swing, and overnight shifts based upon availability.- 90-Day Raise and Performance Bonuses– Start building your career and earning more, fast.- Growth Opportunities– We promote from within for those ready to take the next step!Requirements:- Must Pass a Drug Test – This is a non-negotiable requirement.- Experience & Knowledge – Prior security experience is a plus, but we’re willing to train the right candidates.- Credentials – You must possess:- A valid Texas ID or Driver’s License.- A valid Socia

Houston, TX 77043 • (43.2 miles) • Full Time • 9/28/2026

Description: Job SummaryThe Night Auditor is responsible for the preparation and disposition of all Night Audit work. Responsible for the front desk operation during the overnight shift (Typically 11pm-7am). Primary responsibilities include: registering guests, making reservations, preparing daily reports, balancing transactions, and conducting security walks.Education & ExperienceAt least 1 year of progressive experience in a hotel or a related field required.High School diploma or equivalent required.College course work in related field helpful.Previous supervisory responsibility preferred.Must be able to work independently and with minimal supervision.Knowledge of Accounting Principles.Must be able to problem solve and troubleshoot in order to resolve guest issues that may arise and res

Houston, TX • (44.9 miles) • Full Time • 9/28/2026

We are looking for an experienced Low Voltage Technician to join the team at Nexus Technology and Security, a small business based in Houston, TX. The company operates in several states, including Louisiana, Texas, Oklahoma and Arkansas. This role involves installation, maintenance and service of Access Control, CCTV and Intrusion Detection systems in commercial, industrial, and enterprise environments. The ideal candidate’s home base is Houston, TX or Dallas, TX.To be successful in this role, you need:Three to four years of experience with electronic security systems (access control, CCTV, and intrusion detection)Low voltage wiring experienceAbility to troubleshoot programming challenges and follow system instruction manualsExperience with systems such as Lenel, Genetec, Salto, and Avigil

Houston, TX 77064 • (35.3 miles) • Full Time • 9/27/2026

Senior Security Design Engineer Job Description A Senior Security Design Engineer will design, implement, and maintain systems that protect facilities, assets, and personnel, such as card access control, surveillance (CCTV), and intrusion detection. The role will create technical drawings, site layouts, and construction specifications for security systems, utilizing tools like CAD and REVIT. This role will be responsible for providing sales, operational and client support in the design, installation, and commissioning of low voltage security systems and other related systems and software as required. The primary responsibilities will be fully engineering a security system and providing design documentation in CAD/REVIT formats, procurement (BOM) outlines, security device installation detai

Houston, TX • (44.9 miles) • Full Time • 9/26/2026

With a network of nearly 200 branches, Loomis armored transportation, cash management centers, and cash inventory vaults keep cash flowing throughout financial institutions and retail businesses across the US. Loomis prides itself on providing employees with opportunities for career advancement and job satisfaction. In fact, many of our company’s managers, vice presidents, and corporate executives started out in the branches as driver/guards and tellers. Our work can be challenging, but the thousands who have stayed with our company for decades will tell you that if you have the desire to learn and the drive to succeed, Loomis is the place to be. Come join our team! Shift: 1:30 PM - 11:30 PMJob DescriptionAs an Armed Driver Guard (CDL), you work with your team to ensure the safe and secur

Houston, TX • (44.9 miles) • Full Time • 9/26/2026

Job Title: Applications Security AdministratorLocation: Houston, TX Employment Type: Full-Time | Exempt100k-150kBenefits: This position is eligible for medical, dental, vision, 401(k), disability leave, bonus program, and PTO.About the Role:We are seeking an experienced Applications Security Administrator to join our IT team. In this role, you will be responsible for securing enterprise applications, managing user access, and supporting audit and compliance activities. You’ll play a key role in implementing and maintaining identity and access management tools, with a strong focus on SOX compliance, enterprise security tools, and application security best practices.Key Responsibilities:Security Management:Administer and monitor user access across enterprise applications and systemsLead and

Houston, TX • (44.9 miles) • Full Time • 9/26/2026

Med Security is seeking disciplined and proactive Armed Security Supervisors to serve as the operational anchor for our Houston territory. This position is the primary "bridge" between morning and evening shifts and serves as the second-in-command to the Account Manager. The successful candidates will manage field personnel and will assist the Account Manager during their scheduled shifts in handling high-level client needs, emergency staffing decisions, and administrative oversight.Shift Availability (Position requires a clean driving record and a valid Drivers License):Sat and Sunday(Weekend) from 12pm - 8pmMonday through Friday from 12pm to 8pmMonday through Friday from 4pm to midnightKey Responsibilities:Executive Support: Act as the designated representative for the Account Manager in

Houston, TX • (44.9 miles) • Full Time • 9/25/2026

This role may be based in New York City, Washington DC, Chicago, Houston, the San Francisco Bay Area, or Los Angeles.Control Risks is seeking a Physical Security Designer to support the growth of its Built Environment & Infrastructure design practice in North America.The role will prepare and review design drawings, technical documentation, specifications, schedules, reports, and related files for electronic and non-electronic physical protection systems. This includes support to facility upgrades, new construction projects, and multidisciplinary design and delivery processes.The successful candidate will bring practical knowledge of security design, construction documentation, building and life safety codes, industry standards, and related guidelines, working as part of the US-based Ameri

Houston, TX • (44.9 miles) • Full Time • 9/25/2026

Long View. A career that helps you get more out of life. A Long View career helps you get more out of life. We don’t just say it, we prove it. Every day. We’re proud of our reputation as one of North America’s most dynamic IT providers and we’re even prouder of our culture that allows our people to live life to its fullest. At Long View, we create an environment of collaboration and support, of innovation and enthusiasm, of inclusion and belonging. As a member of the Long View team, you’ll see how our company’s core pillars Integrity, Competence, Value, and Fun resonate through the workplace. And in a recent survey, 89% of Long View team members rated Long View as a good or great place to work! Are you a Security professional who excels at designing enterprise-grade security solutions and

Spring, TX 77386 • (24 miles) • Full Time • 9/24/2026

Overview Allied Universal®, North America’s leading security and facility services company, offers rewarding careers that provide you a sense of purpose. While working in a dynamic, welcoming, and collaborative workplace, you will be part of a team that contributes to a culture that positively impacts the communities and customers we serve. Job Description Life doesn’t always follow a fixed schedule. That’s why we created the Security Officer – Part Time Enhanced position: a flexible, dependable option for individuals looking to supplement their income, gain hands-on experience, or work toward a full-time career with the industry leader.As a Armed Security Officer - Rayford Rdin Spring, TX, this role is designed to provide reliable, consistent hours at an assigned site with the flexibility

Spring, TX 77386 • (24 miles) • Full Time • 9/24/2026

About the position:Position: Armed School Security OfficerLocation: Spring, TX 77386Employment Type: Full-TimePay: $20per hourShift times: Monday-Friday 0600-1100 & 1300-1800Daily pay options are available. Payout as soon as the next day!This position involves working in a school environment; candidates will be required to undergo additional screenings, training, and background checks.About us: Cascadia Global Security (CGS) is a veteran-owned, nationwide security company based in the Pacific Northwest. We are growing rapidly and need you on our team! Our Security Specialists range from active-duty military personnel to veterans to civilians looking for a job with upward mobility and employee-centered management. If you want to be a part of something exciting with opportunities for growth,

Houston, TX 77040 • (38.5 miles) • Full Time • 9/24/2026

Technician – Network Datacom SolutionsLocation: Houston, TXEmployment Type: Full-TimePay: Based on experienceAbout Network Datacom SolutionsNetwork Datacom Solutions (NDS) is a leading provider of integrated technology infrastructure specializing in Audio Visual (A/V), Access Control, CCTV, and Structured Cabling systems. Our team delivers high-quality installations and service for commercial, industrial, and enterprise clients across Texas.Position OverviewWe are seeking an experienced and motivated Technician with a strong background in low-voltage systems, including Audio Visual, Access Control, CCTV, and Structured Cabling. The ideal candidate will have hands-on experience, attention to detail, and the ability to take initiative in leading small-to-medium projects as needed.Minimum Req

Houston, TX • (44.9 miles) • Full Time • 9/23/2026

Location:Overseas, Camp Bondsteel Pristina, KosovoBenefits:First-Year Completion BonusTravel AllowanceAnnual PTO AllowanceContinuity Global Solutions CGS - Kosovo, LLC (CGS - Kosovo) is advertising in your community for an exciting opportunity to work overseas on a U.S. Government contract in the Eastern European Country of Kosovo -in the city of Pristina.Whether you are just looking for a job in an exciting location with opportunities for growth or simply want to get your foot in the door in Government contracting where we could help you gain or maintain a security clearance – this opportunity is for you!Summary:The Armed Security Guard provides security, installation access control, roving patrols, surveillance, monitoring and overall safeguarding to the installation and its tenants. Thi

Houston, TX 77032-2943 • (44.9 miles) • Full Time • 9/22/2026

About the PositionFirst Call Security Innovations LLC is looking for a motivated Business Development Representative (BDR) to help grow our commercial sales pipeline.This is a sales development position focused on identifying new business opportunities, connecting with decision makers, qualifying prospects, and scheduling meetings for our Sales Executives.The ideal candidate is confident on the phone, persistent, organized, competitive, and comfortable with outbound prospecting. Experience in commercial security, electronic security, low voltage, access control, video surveillance, fire alarm, or security integration is a strong plus, but not required.This is an excellent opportunity for someone with B2B sales or business development experience who wants to build a career in the commercial

Houston, TX • (44.9 miles) • Full Time • 9/22/2026

Firetrol Protection Systems is seeking a highly skilled Fire Alarm and Security Service Technician to join our team. As a full-service fire protection, life safety, and security company, we design, install, repair, service, and inspect a wide variety of fire suppression, life protection, and integrated security systems. As a Service Technician, you will be responsible for maintaining and servicing the fire alarm systems for both new and existing customers. The ideal candidate should be highly organized, detail-oriented, and possess excellent communication skills. We value our team members and offer great benefits, growth opportunities, and a positive work culture.Responsibilities Conduct routine maintenance and repair of fire alarm and security systemsHave knowledge of multiple manufacture

Houston, TX 77093 • (40.2 miles) • Full Time • 9/21/2026

Why Pref-Tech?Voted "Top Workplaces" by Houston Chronicle and USA Today! We aim to make “family” a core reason we attract incredible people, retain them, and collectively deliver unequaled quality and service to customers. If your heart and mind are pushing you to join a team who deeply desires to be the best in the world, has a long-game approach to business, prides itself on doing exceptional work, celebrates service to others, and is willing to invest in you, you should consider Pref-Tech.Position Overview: The Sales Manager will manage and grow a local sales force of Sales Professionals to expand market share within the Houston office, while providing additional sales leadership capacity to support the company's continued growth. This is a newly added position created to support busine

Houston, TX 77090 • (29.3 miles) • Full Time • 9/19/2026

About the Company: Sungrow North America is a leading provider of renewable energy solutions, specializing in the development and manufacturing of photovoltaic inverters and energy storage systems. The company offers a comprehensive range of products and services designed to optimize the performance and efficiency of solar power installations. Sungrow North America aims to provide sustainable and reliable energy solutions to meet the growing demand for clean power and is known for its commitment to innovation, high-quality standards, and exceptional customer service.Security Engineer – Network & Identity:The Security Engineer (Network & Identity) is a hands-on engineering role within the IT team responsible for designing, implementing, securing, and automating Sungrow USA's network securit

Houston, TX 77008 • (43.9 miles) • Full Time • 9/19/2026

Benefits:Lifeguard Certification ClassFlexible scheduleFree uniformsOpportunity for advancementTraining & developmentLooking for a job where you can make a difference while having fun? Are you someone who stays alert, loves being around the water, and wants to help keep others safe? Become a Lifeguard and play an important role in creating a safe, fun, and welcoming environment for every swimmer! Job Title: Lifeguard Reports to: Deck Supervisor Summary: Under general supervision, ensures the safety of patrons of the Goldfish Swim School by preventing and responding to emergencies. 1. Maintains constant surveillance of patrons in the facility; acts immediately and appropriately to secure safety of patrons in the event of an accident or emergency. 2. Communicate the rules of the facility to

Houston, TX 77086 • (35.4 miles) • Full Time • 9/18/2026

HomePro is seeking a skilled Install Technician in the fields of Security, AV, and Networking to join our vibrant team. If you are someone passionate about technology and customer satisfaction, we would love to hear from you.Role Overview This position involves the installation, maintenance, and troubleshooting of security, audio-visual (AV), and networking systems in residential and commercial spaces to meet clients' high expectations and ensure their satisfaction with our services.Why Join Us? Opportunity to work in a progressive tech environmentFull benefits package including health, dental, and vision insuranceCompetitive salaryPaid time off and company holidays401K with company matchContinuous learning and development opportunitiesTake home company vehicle & gas cardKey Responsibiliti

The Woodlands, TX • (17.9 miles) • Full Time • 9/18/2026

FULL-TIME POSITIONS AVAILABLEPriceless Protection Resources LLCTexas Private Security License: C28444101Job DescriptionPriceless Protection Resources LLC is seeking professional, dependable, and service-minded Level III Armed Security Officers for specialized church security assignments.Church security requires a unique balance of vigilance, professionalism, hospitality, sound judgment, and de-escalation. Officers must be able to maintain a strong security presence while interacting respectfully with church members, visitors, staff, volunteers, and ministry leadership.This is not a traditional stand-post position. Candidates must be prepared to actively patrol, monitor activity, support access control, respond to incidents and emergencies, and help maintain a safe and welcoming worship env

Houston, TX 77008 • (43.9 miles) • Full Time • 9/17/2026

Azure Infrastructure & Security AdministratorGet to Know Us: CG Infinity, Inc. is a technology consulting firm that was founded in 1998. We offer solutions that are tailored to the needs of each individual client that we work with instead of offering standard, run-of-the-mill solutions to everyone. We work closely with our clients throughout the entire process and offer solutions for a myriad of challenges. Our Culture: Our people-first approach to technology offers best-in-class service and customer success rates. Here are some of the main services that we offer at CG Infinity: Salesforce Implementations, Customer Experience & CRM, Application Development & Integration, Production Support & QA, and Data Analytics & AI. Position Overview: CG Infinity is seeking a motivated and detail-orien

Humble, TX 77396 • (35.9 miles) • Full Time • 9/17/2026

Fire Alarm/Portable Fire Extinguisher TechnicianAbout UsHouston Fire & Security is a highly respected full-service fire protection company that offers exceptional fire safety solutions for a diverse range of fire protection systems. We provide comprehensive services, including design, installation, repair, inspection, and maintenance, for commercial fire protection systems. With the ever-changing codes and regulations, we assist you in ensuring that your building complies with the latest standards. Whether it’s a mid-rise commercial or high-rise commercial building, we provide regularly scheduled fire protection inspections and maintenance to maintain the optimal functionality of your system.Job OverviewThis is a full-time on-site role for a Fire Alarm Technician based in Humble, TX. The F

Houston, TX • (44.9 miles) • Full Time • 9/16/2026

Are you an experienced Alarm Installer/AV Technician looking for a great opportunity? Join a company that values your skills and offers steady, rewarding work! This role focuses oncustomresidentialhomes. Ready to take the next step in your career? Apply today and join a team that values your expertise!Responsibilities:Install access door hardware (some wire pulling involved).Read and interpret plans and blueprints with confidence.Work independently while collaborating with a supportive team.Troubleshoot complex system issues and implement effective solutions.Build strong relationships with customers by providing efficient and reliable service.Conduct site surveys to assess installation requirements.Stay up to date with training and team meetings.Take on additional tasks as needed.Requirem

Tomball, TX 77375 • (24.2 miles) • Full Time • 9/15/2026

About Us We’re a growing Managed Services Provider (MSP) dedicated to supporting credit unions with their IT and cybersecurity needs. Our mission is simple: keep our clients’ technology secure, reliable, and running smoothly so they can focus on serving their members. We value teamwork, curiosity, and innovation, and we believe that doing great work should also be fun. If you’re eager to build your cybersecurity career in a supportive, fast-growing environment, you’ll feel right at home here.The Position: The Security Analyst is an entry-level cybersecurity professional responsible for monitoring, analyzing, and supporting our client's organization’s security. This role focuses on operational security and works closely with outsourced Security Operations Centers (SOCs), internal Informatio

Houston, TX 77073 • (30.3 miles) • Full Time • 9/15/2026

HSSE AdvisorMake An Impact With USThe HSSE Advisor will be a business representative for health, safety, security and environmental (HSSE) programs, ensuring compliance with Vallourec policies and standards, maintaining compliance with ISO Certification standards, and all local, state, and federal regulations. An HSSE Advisor is responsible for promoting a proactive HSSE culture and driving a continuous improvement-based HSSE management system. An HSSE Advisor will collaboration across business departments to align/standardize health, safety, security and environmental programs. An HSSE Advisor is responsible to support development of World Best in Class programs in HSSE Leadership, Management Systems and Culture to deliver on Vallourec’s ambitions for 2030 and beyond.Your Role at a Glance

Houston, TX 77040 • (38.5 miles) • Full Time • 9/15/2026

Description: Objective:Installation Helper to assist in the installation, maintenance, and servicing of fire alarm systems. The ideal candidate will have a basic understanding of electrical systems, excellent attention to detail, and a strong willingness to learn and grow within the field. This role provides hands-on experience in the fire safety industry while working alongside experienced technicians.ResponsibilitiesAssist in the installation and maintenance of low voltage systems.Help troubleshoot and repair low voltage systems and components.Work with the technician to test and inspect low voltage systems for proper operation.Support the setup and wiring of low voltage equipment, including control panels, and devices.Handle tools, equipment, and materials related to low voltage systems

Houston, TX • (44.9 miles) • Full Time • 9/15/2026

Exciting Security / Soc Analyst III, 6 months contract opportunity in Houston, TX.Requirements5 plus years experience in the security domain, Incident Response, threat monitoring, and handling incidents (incident triage and response)Determine detection requirements for data sources being on-boarded to the SIEM, and assessing the value of in place SIEM detection cases, in order to determine gaps and overlap in the overall detection scheme.Perform security monitoring and incident response of cyber security events for proper determination of being considered a cybersecurity event.Triage offenses for false positivesHands-on experience defining detection or protection schemes based on industry standards and frameworks.SIEM, Endpoint Detection and Response, Firewall/IPS/IDS, Proxy, Data Loss Pre

Houston, TX • (44.9 miles) • Full Time • 9/15/2026

Job Summary: This position is responsible for the installation and activation of monitored security systems through the Company. Is responsible for trouble shooting and repairing these systems when needed. It also helps with other low voltage/AV/network installations of products purchased by the customer.Responsibilities:Basic alarm panel programming.· Basic networking knowledge from router set up, terminating all fittings (Cat 5, Cat 6, R66, BNC, etc.) and inserts.· Speaker installs and volume controls.· Able to find cables or tone cables in walls.· Assists with television hangs.· Able to install WI-FI packages.· Activations for Alarm.com and Total Connect.· Able to install cameras and DVRs.· Knowledge of security panels.· Television hangs without help.· Able to hook up audio/amps.· Proje

Prairie View, TX • (38.6 miles) • Full Time • 9/11/2026

Fortinet Network Security EngineerWe are looking for a hands-on Fortinet expert with strong experience working with Fortinet network security solutions.The primary requirement for this role is deep, practical Fortinet experience. We are looking for someone who has worked extensively with Fortinet technologies and can independently configure, manage, troubleshoot, and support Fortinet environments.What we're looking for:Strong hands-on experience with Fortinet / FortiGateConfiguration, administration, and troubleshooting of Fortinet firewallsExperience with firewall policies, NAT, VPNs, security profiles, and related Fortinet security featuresExperience managing and troubleshooting Fortinet environments in productionFamiliarity with FortiManager and FortiAnalyzer is preferredAbility to inde

Houston, TX 77008 • (43.9 miles) • Full Time • 9/10/2026

Benefits:Free uniformsOpportunity for advancementTraining & developmentFlexible scheduleSaving and changing lives, every single day. We have a mission to teach kids how to swim and be safer, in and around the water, while making their experience GOLDEN! Working for Goldfish Swim School will allow you to provide children and families with necessary life skills to combat the ever-growing drowning statistics. Whether you are in the pool leading instruction for our swimmers or warmly greeting our members in our tropical lobby as a front desk representative, you are making an impact. Perks and Benefits:Paid on-the-job trainingFlexible schedulingCulture driven companyEmployee recognition programsPrimary Responsibilities:Keep swimmers safe with lifeguard supervisionProvide any first aid necessary

Houston, TX 77066 • (32.8 miles) • Full Time • 9/9/2026

Job Summary:The Fire Alarm Technicianis responsible forthe installation, testing, inspection, service, and repair of fire alarm systems. Respond to emergency and maintenance calls and troubleshoot/replace faulty devices to restore alarm panels to “normal condition”.Complete inspection and service reports.Supervisory Responsibilities:NoneEssential Job Functions:Traveltocustomerlocationstoperforminstallation,service,andupgradesoffirealarmsystems.Respondtoemergencysituationsduringandafterbusinesshourstoresolvesafetyconcerns.PerformAnnualandSemi-annualinspectionofLifeSafetySystems.Write and provide inspection/service reports on tested equipment and devices.Indicate any deficiencies or corrections that need tobemade.Troubleshootanddiagnosefaultsormalfunctionsinfirealarmsystemsandtakeappropriate

Houston, TX 77041 • (39.8 miles) • Full Time • 9/8/2026

Are you a lead-generating, prospecting, relationship-building, sales machine? Do you love the challenge of discovering potential clients, reaching out to them, and maintaining relationships? If so, we should talk.We arePower Plus!A multi-industry leader in providing power when you need it, where you need it through intelligent and efficient power solutions. We work with Fortune 100 companies across the country such as Amazon, Wal-Mart, Costco, and more. We’ve built a more than 35-year reputation for excellence through our commitment to developing our people, providing exceptional, relationship-based customer service, and giving back to the community. Our biggest differentiator is the quality of our people, and the working environment we create for them, which really has to be seen to be be

Humble, TX 77338 • (31.6 miles) • Part Time • 9/7/2026

Primary Responsibilities: Supports Shrinkage and Safety Awareness programs: Aids Store Management to communicate current shrinkage and safety topics.Conducting surveillance: Observes customer's and contractor's (CCTV/floor) activities to detect theft, fraud or suspicious activity, collects investigative intelligence related to ORC activity and fraud, takes direction from AP management to monitor team member activity as needed, reports infractions of company policy to AP and/or store management.Detaining and Interviewing suspects: Conducts interviews in accordance with local laws and Company policy on customers and contractors suspected of theft, reports suspected fraud to AP management or Market Investigations as needed.Maintaining records: Creates and manages records using approved Compan