Please Accept our Privacy Policy
Ace Electric
Kennesaw, GA 30144 • (15.3 miles) • Full Time • 9/20/2026
Project Manager – Electrical Contractor: Mission Critical | Data Centers | Hyperscale WorkKennesaw, GeorgiaBuild the Infrastructure Behind the World’s Most Critical OperationsAce Electric is hiring Project Managers to lead large-scale electrical construction projects across the U.S., with a primary focus ondata center construction and other hyperscale mission-critical projects.This role is based out of our Kennesaw, Georgia division, with flexibility to:Work from Jackson with routine travel to active projects, orBe embedded on-site as a Project ManagerIf you’re wired for pace, ownership, and high-impact workthis is where you step up.What You’ll OwnFull lifecycle management of multi-million-dollar electrical projectsProject financials: forecasting, cost control, and profitabilityCoordinatioWorkspire
Atlanta, GA • (15.8 miles) • Full Time • 9/15/2026
Senior Electrical Project ManagerLocation: Atlanta, GA | Fully onsiteCompensation: Up to $170,000 base salary, based on experienceSchedule: Six 10-hour shifts per week during active project executionAbout the RoleWorkspire is partnering with an established specialty contractor supporting complex electrical and infrastructure projects across the United States. The organization is expanding its mission-critical construction capabilities and is seeking a proven project leader to help deliver a large-scale greenfield data center development.The Senior Electrical Project Manager will own the electrical scope from early field mobilization through commissioning and energization. Reporting to project leadership, this person will be responsible for cost, schedule, quality, safety, documentation, anPearce Services
Atlanta, GA • (15.8 miles) • Full Time • 9/15/2026
At PEARCE, we've got a career for you!Pearce is a leading technology-enabled provider of asset management solutions for mission-critical electromechanical infrastructure throughout North America. Pearce provides technical maintenance, repair, operations, and engineering services for uninterruptible power supply (UPS) systems, backup power generators, battery energy storage systems (BESS), critical cooling systems, and other electrical and mechanical infrastructure across end markets such as renewable energy, telecom, and data centers. Founded in 1998, Pearce has more than 4,000 employees and 28 locations across the U.S. Pearce is a wholly owned subsidiary of CBRE Group, Inc., the world's largest commercial real estate services and investment firm. To learn more about Pearce visit http://wwContact Government Services, LLC
Atlanta, GA • (15.8 miles) • Full Time • 9/2/2026
Jira Lead Admin Employment Type: Full-Time, Mid Level Department: Information Technology CGS is seeking a talented Jira Lead Administrator who is passionate about driving transformation in the federal IT domain to join our growing team of technology and software consulting professionals. Strong candidates will have a desire to drive change in the federal space by developing executable strategies, implementing new technologies, streamlining processes, and improving the delivery of mission value delivery through new practices and tools. CGS brings motivated, highly skilled, and creative people together to solve the government’s most dynamic problems with cutting-edge technology. To carry out our mission, we are seeking candidates who are excited to contribute to government innovation, appreHilton Mechanical Contractors
Alpharetta, GA • (7.2 miles) • Full Time • 9/26/2026
About the Role Hilton Mechanical Contractors hires across a wide range of trades, support, and administrative roles that we don't always have posted at any given time. If you have experience that fits our work and you'd like to be considered, submit your application here and tell us what you do.Every application submitted through this posting is reviewed by our HR and hiring team and routed to the appropriate manager.Roles filled through this application may include, but are not limited to:Field & Trades mechanical piping, HVAC, plumbing, plastic fusion, ironwork, rigging, general laborFabrication & Shop fab shop production, material handling, shop supportPreconstruction & Project Support estimating, project coordination, project management support, purchasingFleet, Facilities & WarehouseCobb Convention Center-Atlanta
Atlanta, GA 30339 • (10.7 miles) • Full Time • 9/26/2026
Description: The Facility Service Engineer 1 is responsible for the operation and maintenance of electrical services as prescribed and will perform within the Engineering Department guidelines, to include but not limited to: performing preventive maintenance of electrical installations, preventive maintenance of HVAC systems, Preventive Maintenance of Plumbing Systems, exhibitor utility services installation for water, power, etc., utility services supply inventory checks, exhibit hall maintenance, monitoring operation techniques as to safety procedures, complying with equipment distribution requests, review required operation techniques, completing daily routine and/or event assignments as required, and such other functions and duties as required. Requirements: Experience· 2 years’ experiCommunications Engineering Company
Atlanta, GA 30361 • (13.3 miles) • Full Time • 9/26/2026
CEC is a great place to accelerate your career. Here are just some of the things we offer:Advancement opportunity- Our systems technicians often go on to become, master technicians, and engineers.Professional growth- We believe in investing in our employees so they can take exceptional care of our clients. We also offer a lucrative bonus program tied to continuous learning and training.Employee focused- We prioritize work/life balance and offer competitive compensation, health benefits, and paid time off so you can put family first.OBJECTIVE:Lead the physical installation of security systems on all assigned projects. Work alongside the project team to ensure safety and quality objectives are met by adhering to industry codes, standards, and best practices.CORE RESPONSIBILITIES include, butFresh Express
Morrow, GA 30260 • (27.1 miles) • Full Time • 9/26/2026
Quality Assurance LeadFood Safety Role & Responsibility: As an individual, the incumbent must understand the Food Safety Statement, complete the required training, perform work assignments in accordance with training and display an acceptable level of competency with all Quality Assurance/Safety/Security policies and training requirements. Areas of food safety training will include, but are not limited to, GMP, HACCP, Food Safety and Quality Statement, FSSC 22000/Global Food Safety Policy/Food Safety Goals, Visitor/Food/Site Security, Emergency Preparedness, and Bloodborne Pathogens. Some additional items will include: CCP's, GLP's, Hold/Release, and Environmental Sampling.The individual must also request additional and/or refresher training if he or she feels that it is needed to effectivEuna Solutions
Atlanta, GA 30338 • (2.6 miles) • Full Time • 9/26/2026
The Opportunity:We are seeking a Team Lead, Technical Solutions, who'll lead a team of 4 Technical Solutions Specialists through requirements gathering, configuration, and implementation of payment solutions for our customers. You will collaborate closely with cross-functional teams including sales, product management, engineering, customer success, and technical support - to deliver exceptional client experiences and drive customer satisfaction. This role combines deep technical expertise, sophisticated consultant skills, and leadership to deliver high-quality solutions while partnering with product teams on innovative feature development. You'll be the expert our customers and team turn to for guidance on payment integrations, API architecture, and complex technical challenges.Key ResponAscend Aesthetic Partners
Atlanta, GA 30346 • (3.8 miles) • Full Time • 9/26/2026
About UsAscend Aesthetic Partnersis a premier management services organization (MSO) dedicated to supporting exceptional plastic surgery and aesthetic practices for multiple states. We partner with leading surgeons and healthcare professionals to provide the operational expertise, strategic resources, and innovative solutions they need to deliver outstanding patient care while growing thriving, sustainable practices.Our comprehensive support includes human resources, finance, marketing, compliance, revenue cycle management, information technology, business development, and operational leadership. By handling the complexities of practice management, we empower our physician partners and clinical teams to focus on what matters mostdelivering exceptional patient experiences and achieving lifeMunicipal Electric Authority Of GA
Atlanta, GA 30328 • (4.4 miles) • Full Time • 9/26/2026
Position Title: Senior Systems AnalystDepartment: Information ServicesReports to: Manager, Application Development and SupportLocation: Atlanta, GA (*On-Site)* During the first three (3) months of employment the incumbent will be required to work five (5) days a week onsite in the office, however thereafter they will be given the opportunity to work remotely one (1) day per week with manager approval.Summary:This position participates as a member of the team to deliver reliable, efficient and high performing technology-based solutions; assists in the design, development, testing, support, and maintenance of multiple business applications (both packaged and custom); works in a constructive and determined manner to execute the strategies and goals determined by management.Key ResponsibilitieSafe-Guard Products International LLC
Atlanta, GA 30328 • (4.4 miles) • Full Time • 9/26/2026
Please do not respond to direct messages with your personal information. All job applications and your sensitive, personal information should only be submitted via our official job platform.External Job Title: Full Stack Manager- Java and Angular(hybrid onsite Monday- Thursday)Internal Job Title:Manager, Software EngineeringLocation: US-GA-Atlanta (Sandy Springs)FLSA: Exempt#LI-HybridJob Overview:We are seeking a Manager of Software Engineering to lead a full-stack engineering team of 10+ engineers across onshore and offshore locations, owning our Contract Cancellations and Claims Payments platforms, including both internal and external-facing applications. This role reports to the Sr. Engineering Manager over Claims and Cancellations and is responsible for the delivery, stability, and modSygna Solutions
Alpharetta, GA 30022 • (6 miles) • Full Time • 9/26/2026
Location: Alpharetta, GA – OnsiteEmployment Type: Full-Time / ContractExperience: 10+ Years in SAP FICOBusiness-Facing Experience: Strong client-facing/business explanation experience; ideally less than 5 years in a dedicated business-facing/functional advisory capacity.Role Overview:We are looking for a highly experienced SAP FICO Business Consultant with 10+ years of hands-on SAP FICO experience who can work directly with business stakeholders and clients.The ideal candidate should have strong SAP FICO knowledge and, most importantly, the ability to understand complex technical/functional topics and explain them clearly to clients, business users, and leadership. The consultant must be confident in client meetings, requirement discussions, solution walkthroughs, and presentations.Ideal CBeckhoff Automation Llc
Alpharetta, GA 30009 • (7 miles) • Full Time • 9/26/2026
Beckhoff Automation is seeking a technically motivated, customer-centric Automotive Industry Application Engineer to help shape the future of automation in the North American. In this high-impact role, you will serve as a trusted technical partner to our automotive customers, enabling their success with cutting-edge automation, control, and end-of-line test solutions.Working closely with our Automotive Industry Manager and global stakeholders, you’ll play a key role in executing our go-to-market strategy, driving the adoption of Beckhoff technologies, and contributing to growth across leading OEMs and Tier suppliers. This position blends deep technical engagement with strategic industry focus in one of Beckhoff’s most dynamic verticals.The ideal candidate thrives at the intersection of engDATASEERS INC
Alpharetta, GA • (7.2 miles) • Full Time • 9/26/2026
Role Summary DataSeers is looking for experienced ETL Developers / Data Engineers with HPCC Systems and ECL experience to build and maintain large-scale financial data pipelines.A significant portion of DataSeers' data ingestion, normalization, transformation, linking, enrichment, and analytical processing is performed using HPCC Systems and Enterprise Control Language (ECL).This is not a traditional SQL-only ETL position. You will work with large and complex financial datasets and develop ECL-based data workflows that transform disparate source data into standardized, reliable datasets used across DataSeers products.You will work with data from banks, credit unions, fintechs, payment processors, core banking systems, and other financial platforms.What You Will Do Develop, maintain, and opSageNet LLC
Marietta, GA 30067 • (8 miles) • Full Time • 9/26/2026
WHO WE ARE Empowering Connections, Inspiring PossibilitySageNet is a leading managed services provider specializing in connectivity, digital signage and cybersecurity. The company connects, manages and protects technologies and devices across widely distributed enterprises. SageNet’s people, processes and technologies, coupled with its collaborative approach, empowers customers to achieve their core business objectives.The company offers world-class service and support via its US-based 24/7/365 Network Operations Centers and Security Operations Centers, geographically diverse teleports, a central National Logistics Center, multiple data centers, and a nationwide field service organization.What makes SageNet unique is its Why. SageNet is passionate about Trusted Connections. This is a two-fThe FDA Group
Atlanta, GA 30301 • (9.2 miles) • Full Time • 9/26/2026
Medical Device Quality Systems & FDA Inspection Readiness ConsultantLocation: Atlanta/Duluth, Georgia areaWork Arrangement: OnsiteDuration: Immediate start through November 2026, with potential extensionStart: ImmediatePosition OverviewWe are seeking an experienced Medical Device Quality Systems Consultant to provide hands-on support for the startup of a new Class I medical device contract manufacturing operation.The consultant will support Quality Management System (QMS) implementation, development of auditable quality and operational processes, system validation, and FDA inspection readiness. A key focus will be ensuring appropriate controls are established across production, warehousing, inventory, traceability, product hold/quarantine, release, and direct-to-consumer distribution activAVASO Technology Solutions Inc
Norcross, GA 30093 • (10.1 miles) • Full Time • 9/26/2026
JobDescriptionSummary:TheITFieldTicketCoordinator’sresponsibilitiesaretoreceive,validate,schedulewithcustomer,plan,andassignticketstodesignatedfieldtechniciansforpartspick-upsandhardwareITrepairservices.TheITfieldticketcoordinatorwillcommunicatedirectlywiththedesignatedfieldtechniciansresponsibleforservicesaswellaswiththeend-customersrequestingservice.TheITFieldTicketCoordinatorwillberequiredtoadheretocontractualServiceLevelAgreements(“SLAs”).KeyResponsibilities:Receive, validate, update, and end-user requests for hardware repair services via ticketing system and in compliance with contractual SLAs.Schedulerepairserviceswithend-usersviaphoneand/ore-mail.Planandassigndesignatedfieldtechnicianstoend-userserviceticketsasefficientlyaspossible.Providecustomerservicesupportviaphoneand/ore-mail.CEstrem & Co.
Atlanta, GA 30305 • (10.4 miles) • Full Time • 9/26/2026
Assistant Project Manager – Commercial Construction | Atlanta, GeorgiaReady to take the next step in your construction management career? We're looking for an Assistant Project Manager to support commercial construction projects and learn alongside experienced industry professionals.About the CompanyOrdner Construction has spent nearly four decades building lasting relationships through quality commercial construction services. The company offers exposure to a wide variety of project types while providing opportunities for professional growth and advancement.What You'll DoManage RFIs, submittals, and project documentationAssist with scheduling, procurement, and cost trackingCoordinate subcontractors and vendorsSupport project managers throughout the project lifecycleHelp ensure successfulHueman PE Talent Solutions
Atlanta, GA 30339 • (10.7 miles) • Full Time • 9/26/2026
Strategic Implementation Manager opportunity with Connexure in Atlanta, Georgia. Connexure is a software company fully dedicated to serving the self-funded medical benefits ecosystem. Our software helps stop-loss carriers, brokers, and third-party administrators quote, underwrite, and administer stop-loss policies. Our mission is to unify the self-funded medical ecosystem through integrated technologies, artificial intelligence, processes, and data insights. Our leadership team believes in a customer-centric approach to driving value and creating a network effect where the software becomes value-additive through stakeholder interoperability. We are looking for talented and motivated individuals who align with our vision and will support the next phase of growth.The Implementation Manager oGeorgia System Operations Corporation
Tucker, GA 30084 • (10.9 miles) • Full Time • 9/26/2026
Senior Energy Systems Analyst III - IVDesign, Support, and Improve Critical Energy Billing and Settlement SystemsGeorgia System Operations Corporation (GSOC) is seeking a Senior Energy Systems Analyst to provide functional and technical ownership of the applications, data processes, controls, and business rules that support accurate and timely Member billing, energy settlements, contract calculations, and related reporting across the Family of Companies.This role combines business systems analysis, application development, data analytics, and technical leadership to ensure critical energy billing and settlement solutions remain accurate, reliable, scalable, and audit-ready.The Senior Energy Systems Analyst designs, develops, supports, and improves solutions using Excel/VBA, SQL, MicrosoftSOUTHEASTERN CYBER LLC
Atlanta, GA 30332 • (14.5 miles) • Full Time • 9/26/2026
Benefits:Flexible scheduleTraining & developmentRole Summary Southeastern Cyber LLC is seeking a Digital Design / Toolchain Engineer to extend our proprietary toolchains and pipelines. The engineer will integrate various policies into an automated flow for system and hardware design. Responsibilities - Develop and extend EDA/RTL compilation tools and scripts (Python, C++, and/or Rust). - Map quantified requirements into physical standard-cell routing and logic structures. - Run synthesis, place-and-route, and area/power/timing (PPA) estimates to sweep architectural scaling limits (max model parameter count, max whitelist/blacklist size). - Interface with the Principal Investigator and Hardware SME to ensure correct RTL generation and physical implementation. Required Qualifications - B.S.Legacy Mechanical Services Parent LLC
Kennesaw, GA 30144 • (15.3 miles) • Full Time • 9/26/2026
Legacy Mechanical, a Crete United Company is looking to hire a Senior Controls Technician/Project Manager in the Kennesaw, GA area. The Senior Controls Technician/Project Manager is responsible for field installation, system programming, and commissioning, while also being self-sufficient in managing and successfully completing projects throughout the full project lifecycle (estimating, selling, and managing Mechanical/Construction Projects). This role is intended to support both our current workload and our continued growth in the controls segment of the business. This position requires a self-motivated individual who is dependable and process oriented. The employee should have a high level of attention to detail, be accurate and consistent, and work well with others.Qualifications, functMullins Mechanical
Atlanta, GA • (15.8 miles) • Full Time • 9/26/2026
About YouAre you a client focused construction leader who actively works to ensure project profitability? Do you have a 'can do' attitude and an unwavering commitment to excellence? If this sounds like you, then you should mull over a career with Mullins Mechanical.We're looking for an experienced Project Executive to join our team. As a Project Executive at Mullins, you will be a key player in managing and guiding construction projects from inception to completion. Your responsibilities will include leading mega projects while mentoring and advising Senior Project Managers, Project Managers, and Assistant Project Managers, overseeing high-profile and complex projects, and developing strong client relationships. Your role will encompass various aspects from project setup to closeout, and yMoore Colson
Atlanta, GA • (15.8 miles) • Full Time • 9/26/2026
Company Overview: Moore Colson is a leading CPA and consulting firm in Atlanta with over 40 years of experience. Known for its collaborative, client-focused approach, Moore Colson offers a wide range of services to help businesses grow and achieve their goals. Moore Colson has an exciting internship opportunity for dynamic, motivated, and self-driven students to join ourAssurance teamin Atlanta fromJanuary - April 2028. This is an excellent chance to gain hands-on experience in auditing and public accounting, preparing you for a successful career in the field. The successful candidates will work closely with our experienced audit professionals and get exposure to various aspects of audit practice. Key Responsibilities: Preparing financial statements and related disclosures in accordance wiCapTech Consulting
Atlanta, GA • (15.8 miles) • Full Time • 9/26/2026
Company Description CapTech is a technology consulting firm dedicated to helping clients achieve their business objectives through innovative technology solutions. With a commitment to excellence and collaboration, CapTech partners with leading companies to deliver digital transformation, software development, and technology consulting services.Job Description Consulting at CapTechPartner with clients on crossfunctional, teambased projects to deliver scalable Salesforce solutions across the full Software Development Lifecycle (SDLC) using Agile methodologiesServe as a trusted technical advisor, managing architectural scope while aligning technical solutions with business goalsCommunicate effectively with both technical and nontechnical stakeholders, setting clear expectations and guiding dCato Networks
Atlanta, GA • (15.8 miles) • Full Time • 9/26/2026
Welcome to the future of cloud networking and security!Cato Networks is the first company to converge enterprise networking and security into one centralized and global service that is delivered by cloud. It is led by networking and security pioneer Shlomo Kramer (Check Point, Imperva) and early investor (Palo Alto Networks, Exabeam, Trusteer and more). Cato's unique technology inspired a brand-new product category, later named "SASE" by Gartner and a market expected to reach $28.5 billion by 2028. This is your opportunity to get on the rocket ship and join a company that is building a cutting-edge enterprise network and secure cloud platform, and is on a fast track to becoming the worldwide market leader – don't miss it!As Technical Enablement Team Lead, you will lead the strategy, executClarkston Consulting
Atlanta, GA • (15.8 miles) • Full Time • 9/26/2026
This job is posted in multiple locations. When not at a client site, consultants work from their home office. Relocation is not required.Clarkston Consulting is seeking motivated, self-driven leaders who are energized by team results and interested in joining a firm that values its culture and people as its biggest strengths. Come join us as an SAP PP Senior Consultant, and in this role, you will deliver creative business solutions to our market-leading clients in the life sciences, consumer products, and retail industries.Together, we can find the answers to our clients' most challenging business problems through a combination of our industry expertise, business process knowledge, and consulting excellence.What You’ll DoAs an SAP PP Senior Consultant at Clarkston you will:Lead and guide cOneTrust
Atlanta, GA • (15.8 miles) • Full Time • 9/26/2026
Strength in Trust OneTrust's mission is to enable innovation through the responsible use of data and AI. We believe that ensuring data is trusted shouldn't slow teams downit should accelerate what's possible. This led us to develop the first technology platform for responsible data use in 2016. Today, with AI representing the latest and most impactful expansion of data yet, OneTrust is once again redefining what responsible innovation looks like. OneTrust, the AIReady Governance Platform, unifies regulatory intelligence, automation, and connected governance workflows so businesses can continue to move at the speed of AI while ensuring good governance to prevent data misuse at scale. Trusted by thousands of organizations worldwide, OneTrust is shaping the future where trusted data becomesConcrete Careers, LLC
Kennesaw, GA • (16.6 miles) • Full Time • 9/26/2026
Key ResponsibilitiesCreate / produce information models related to project definition or updates during the construction phase.Update information models to reflect changes occurring in the asset during the operational phase.Develop information models according to the BIM uses requested by the appointing party.Prepare BIM models for coordination with other stakeholders, following the guidelines of the project’s BIM coordinatorsand client requirements.Resolve assigned clashes and coordination issues.Report coordination issues for further review. (RFI)Prepare documentation required to meet deliverables related to both development and operational phase processes.(Panel Book & Panel Layout)Develop and maintain both graphical and non-graphical models in accordance with the project standards.PrepTHE UPS STORE
Lawrenceville, GA • (19.6 miles) • Full Time • 9/26/2026
The Graphic Designer is responsible for following through on all customer graphics orders and will help with volume copying. In addition to effective conceptualization abilities, strong design skills, and technical expertise, the Graphic Designer must be highly collaborative by nature and must have demonstrated strengths in graphics design, project management, and communication. The ideal candidate has a Bachelor’s degree in visual communication, graphic design, or a related field; at least two years of experience in graphic design or in the print industry, and is skilled in copy-editing/proof-reading and desktop publishing. He or she must have full mastery of various software design programs including Adobe-based platforms (Acrobat, InDesign, Illustrator, and Photoshop) for both Mac and PMetro Supply Chain Holdings USA Inc
Atlanta, GA 30337 • (24.3 miles) • Full Time • 9/26/2026
You are invited to apply for Metro Supply Chain Holdings...Now accepting Open Applications.Hydro North America
Gainesville, GA 30501 • (37.8 miles) • Full Time • 9/26/2026
Hydro Extrusions is a world-leading aluminium extrusion business counting around 100 production sites in 40 countries and employing 20,000 people. Through our unique combination of local expertise, global network, and unmatched R&D capabilities, we can offer everything from standards profiles to advanced development and manufacturing for most industries.Since 1905, Hydro has turned natural resources into valuable products for people and businesses with focus on a safe and good workplace for our 30,000 employees in more than 140 locations.What we offer youMedical, Rx, Dental, Disability, Life Insurance, Flexible Spending AccountsRetirement Savings Plans with Company Match/ContributionsEducation AssistanceBonus Plan EligibilityParental LeaveWhat you will be doingJob Summary: The ReliabilityMomnt
Atlanta, GA 30328 • (4.4 miles) • Full Time • 9/26/2026
Momnt is an expanding financial technology company specializing in embedded lending and point-of-need consumer financing based in Sandy Springs, GA. We are transforming how merchants provide financing to their customers with our embedded lending platform. Our platform delivers a seamless digital experience that makes financing simple, fast, and affordable, connecting high-quality lenders with merchants, primarily in the home improvement sector, to empower consumers to pay for the things they need.The Lead Cloud & Platform Architect is responsible for designing, implementing, and directly operating the company's cloud and platform infrastructure. This is a true hands-on execution and leadership role that balances strategic cloud architecture with daily code deployment, platform ownership, SAvalon Software Services LLC
Atlanta, GA 30305 • (10.4 miles) • Full Time • 9/26/2026
Job Tite : Oracle SCM Cloud FunctionalDuration : Long TermLocation : Atlanta, GALead and support the implementation of Oracle Cloud SCM modules.Provide expertise in configuring and customizing Oracle Cloud SCM to meet business requirements.Serve as the primary point of contact for application related issues and provide troubleshooting and support.Collaborate with cross-functional teams to ensure successful integration of Oracle Cloud SCM with other systems.Expertise in Order management, Procurement and InventoryLead and participate in system testing and end-user training.Provide support and troubleshooting assistance to end-users.Stay up-to-date on Oracle Cloud Financials functionality and updatesProvide Technical/Functional support to Business Development sales pursuits.FinQuery
Atlanta, GA • (15.8 miles) • Full Time • 9/26/2026
FinQuery stands at the forefront of accounting automation, driven by a deep specialty in contract-driven accounting. Our AI-enabled platform transforms how controllers and finance teams operate, seamlessly managing and accounting for the complex financial contractslike leases, prepaids, and accrualsthat are the backbone of modern business. We are not just a software provider; we are the unified subledger that eliminates time-intensive, error-prone technical accounting workflows, ensuring financial reports are accurate and empowering our customers to focus on strategic, high-value tasks. FinQuery is the global leader in lease accounting (as recognized onG2.com) and serve more than 8,500 customers worldwide. Our growth trajectory has been consistently validated by the Inc 5000, which has reTotal Aerospace Services
Atlanta, GA 30320 • (24.4 miles) • Full Time • 9/26/2026
Our client is seeking a skilled Machinist/Programmer to join their team in Albany, Georgia. The successful candidate will be responsible for CNC programming for mill and lathe parts, creating program setup sheets, aiding in fixturing, recommending tooling, and training others in CNC G-code programming. A key aspect of this role is working on time-saving projects to enhance shop efficiency while being hands-on with team members on the shop floor. Responsibilities:CNC programming for mills and lathesCreation of program setup sheetsFixturing and work holding assistanceTooling recommendations for machining operationsCNC G-code programming training for team membersEquipment scheduling and maintenance collaborationMetrology tool utilization for part measurementComplex setups and programming forDCCM
Gainesville, GA 30501 • (37.8 miles) • Full Time • 9/26/2026
Description: We are seeking a highly experienced Senior Project Manager to lead land and site development projects throughout Georgia. This role is responsible for managing all phases of project deliveryfrom due diligence and entitlement through design, permitting, and construction supportwhile maintaining strong client relationships and ensuring successful project outcomes.The ideal candidate will bring in-depth knowledge of Georgia development regulations, strong leadership skills, and experience managing complex commercial, residential, and mixed-use projects.Key ResponsibilitiesProject Management & DeliveryLead and manage multiple land and site development projects simultaneouslyOversee project scope, schedules, budgets, and quality assuranceDirect multidisciplinary teams including civFruition Executive Search
Atlanta, GA 30338 • (2.6 miles) • Full Time • 9/26/2026
SAP Enterprise ArchitectOur client is a global technology, consulting, and business-services company has been recognized by major organizations for its workplace culture, management consulting, sustainability, ethical business practices, innovation, and talent development. Recent accolades include recognition as one of the World’s Best Employers by Forbes, one of the World’s Most Ethical Companies by Ethisphere, and one of Forbes’ World’s Best Management Consulting Firms. It has also received workplace, sustainability, and employee-development awards from organizations such as Newsweek, TIME, CDP, Frost & Sullivan, and Brandon Hall Group.Position Overview Title: SAP Enterprise Architect Location: Atlanta, GA Duration: FT, Direct-hire Role PurposeLead the enterprise architecture for a largeCypress HCM
Johns Creek, GA • (8.4 miles) • Full Time • 9/26/2026
Director of Analog Engineering This exciting rolewillberesponsibleforleadingthe Analog Design team within the Memory Interface Chipsteam.This hands-on leadership role combines technical analog/mixed-signal circuit design with management of a growing engineering team developing next-generation DDR5/DDR6 memory interface buffer chipsto be successful in this role.The position requires deep expertise in high-speed analog/mixed-signal design and proven leadership in guiding teams through specification, architecture, and productization.They are headquartered in thegreaterAtlanta area. The company is asilicon IP providerfor thesemiconductor manufacturingindustry. If you are an individualwhohas expertise inleadinganalog teams andloves tobehands-on,this role could be for you! Responsibilities: LeadIVision Scale LLC
Atlanta, GA 30339 • (10.7 miles) • Full Time • 9/26/2026
Senior Enterprise Architect Employment Type: Full-timeReports To: VP, Services Portfolio & GTMLocation: Hybrid – Atlanta, GA (WFH flexibility)Travel: ~25% (client meetings, workshops, assessments, industry events).Role Summary We are seeking a Senior Enterprise Architect to serve as a strategic technical advisor across the full customer lifecycle. This role takes a holistic view of a client’s overall technology environment enterprise infrastructure, public cloud, digital workspace, security, and business applications and translates business strategy, risk, and compliance drivers into currentstate assessments, targetstate architectures, and actionable transformation roadmaps aligned to ivision’s services portfolio and our ASSESS ARCHITECT TRANSFORM OPERATE delivery lifecycle.The ideal candi