Peachtree Corners, GA 30092 • (17.1 miles) • Full Time • 9/27/2026

Description: The Project Coordinator is responsible for ensuring all mitigation and restoration projects are properly documented, compliant, and administratively complete. This role supports Project Managers and Operations by verifying job files, maintaining claim accuracy, managing required communications, and ensuring all stabilization and mitigation documentation is completed in a timely and professional manner.Requirements: Primary Duties & ResponsibilitiesFile & Documentation ManagementVerify that all required job photos are uploaded and meet company and insurance documentation standards.Review files in MICA and other internal systems for completeness and accuracy.Ensure claim numbers are obtained and properly entered into each job file.Confirm that scope notes and job notes have been

Atlanta, GA 30328 • (17.6 miles) • Full Time • 9/27/2026

Momnt is an expanding financial technology company specializing in embedded lending and point-of-need consumer financing based in Sandy Springs, GA. We are transforming how merchants provide financing to their customers with our embedded lending platform. Our platform delivers a seamless digital experience that makes financing simple, fast, and affordable, connecting high-quality lenders with merchants, primarily in the home improvement sector, to empower consumers to pay for the things they need.The Lead Cloud & Platform Architect is responsible for designing, implementing, and directly operating the company's cloud and platform infrastructure. This is a true hands-on execution and leadership role that balances strategic cloud architecture with daily code deployment, platform ownership, S

Covington, GA • (22.3 miles) • Full Time • 9/27/2026

Company DescriptionAbsolics Inc. is the world's first glass substrate manufacturer and a leader in advanced packaging technologies. The company provides scalable solutions tailored for businesses in high-performance computing. Absolics pioneers innovative manufacturing techniques to support cutting-edge semiconductor advancements. Located in Covington, GA, the company is positioned at the forefront of the technology industry.Position: SPC Data Control EngineerLocation:COVINGTON, GAJOBSUMMARYDUTIES/RESPONSIBILITIES:SPC System Design and ImplementationProcess Monitoring and ControlData Collection and ManagementData Analysis and InterpretationREQUIREMENTS:Excellent analytical and problem-solving skillsSolid understanding of quality management principles, root cause analysis, and corrective ac

Marietta, GA 30060 • (23.6 miles) • Full Time • 9/27/2026

Rate of Pay: $70,844 - $81,473Status: Open Until FilledThis is an engineering/technical position funded through the Special Purpose Local Option Sales Tax (SPLOST) for Transportation Improvements. Under direction of the City Engineer provides project management, supervision, and technical expertise for the implementation of City transportation improvement projects. Specialty areas for this assignment include, but are not necessarily limited to project management, design, construction management, and construction inspections for transportation, traffic, and storm water infrastructure projects. Employees in this classification ensure regulatory compliance with all applicable standards at the Federal, State and City level and have approval authority for design plans, shop drawings, and specif

Alpharetta, GA • (24.1 miles) • Full Time • 9/27/2026

Base Salary: $64,000 - $100,000Who we are:Illumia is an industry leader in bringing the best integrated technology solutions to education, healthcare, and business campuses worldwide. Illumia was built on the collective expertise of two legacy cultures, and brings together people, technology, and insight to pioneer the art of the experience across the communities we serve. Be a part of this exciting organization and improving the lives of people doing mission-critical work.Why join our team?We strive to provide the best customer experience in the industry and have succeeded with a single, strong motivating principle: We serve our user community.Our success and growth are directly attributed to our people. Our newly named company is dedicated to fostering a culture of integrity, respect, an

Marietta, GA • (24.9 miles) • Full Time • 9/27/2026

Title: SAP S4/HANA Multi-Module Functional LeadCompany Background:We are a mid-size pharmaceutical manufacturing and sales company based out of the United States. Our organization has approx. 650 employees located across multiple facilities and we use SAP S4/HANA as our ERP system. Our S4/HANA system is used by about 150 users across the company and is configured with the FI, MM, WM, PP, and SD modules.Job Description:We are seeking an individual that can lead multiple SAP S4/HANA functional areas. This role requires hands-on knowledge of S4/HANA processes / functions and aims to accomplish the following objectives:Act as a liaison between functional business users and technical support teamsAssist users who run into issues or are unsure how to accomplish tasks in SAPSatisfy SAP related bu

Kennesaw, GA 30144 • (30.9 miles) • Full Time • 9/27/2026

OverviewCircet USA is the leading provider of Network Services in North America, and we're looking for talented professionals to join our team. We specialize in engineering and construction services delivering comprehensive solutions across Inside Plant, Outside Plant, and Wireless networks to meet the evolving infrastructure needs of our customers.With nearly 50 years of industry experience, we work with major telecom service providers, MSOs, cloud service providers, and utilities. At Circet USA, you'll have the opportunity to make an impact by helping to create customized solutions that address our clients' unique challenges. If you’re passionate about innovation and thrive in a dynamic environment, we’d love to hear from you.Circet USA’s benefits package includes the following:Medical,

Atlanta, GA • (12.7 miles) • Full Time • 9/27/2026

OUR COMPANY:EOS IT Solutions is a Global Technology and Logistics company, providing Collaboration and Business IT Support services to some of the world's largest industry leaders, delivering forward-thinking solutions based on multi-domain architecture. Customer satisfaction and commitment to superior quality of service are our top business priorities, along with investing in and supporting our partners and employees.We are a true International IT provider and are proud to deliver our services through global simplicity with trusted transparency.WHAT YOU WILL DO:As a Fiber Optical Splicing Technician, you will be responsible for the installation, splicing, testing, troubleshooting, and maintenance of fiber optic cabling infrastructure. This hybrid role combines the practical skills of an I

Atlanta, GA • (12.7 miles) • Full Time • 9/27/2026

Why Work at SMA AmericaPower the future. Build your career at SMA America.As the U.S. subsidiary of SMA Solar Technology AG, we have been at the forefront of solar inverter technology since 1981, developing solutions that make photovoltaic power plants simpler, more reliable, safer, and more cost effective. Headquartered in Rocklin, California, SMA America has spent more than two decades helping homes, businesses, and utilities across the country generate clean, reliable power. We are the only inverter manufacturer in the world offering solutions for every system size, from residential rooftops to large scale utility plants, backed by more than 1,500 patents and a presence in over 190 countries.Innovation is only part of the story. We invest in our people, create room to grow, challenge co

Atlanta, GA • (12.7 miles) • Full Time • 9/27/2026

At Coinme, we're redefining access to financial services in a digital world. By combining the cutting-edge power of blockchain technology with everyday simplicity, we make digital currencies accessible and usable for all.As the world's largest network of cryptocurrency kiosks with over 40,000 locations nationwide, we're breaking down barriers to crypto adoption through our seamless mobile app, secure digital wallet, and DeFi integrations. Beyond our consumer offerings, we're also the infrastructure powering the crypto revolution for businesses.Through our enterprise Crypto-as-a-Service (CaaS) platform, we enable businesses to launch crypto capabilities in weeks, not months. Our modular, API-first infrastructure provides everything from KYC and payment processing to liquidity and custody so

Alpharetta, GA 30005 • (24.9 miles) • Full Time • 9/27/2026

Location: Alpharetta, GA (Hybrid)Employment Type: Full-Time, ExemptDepartment: MarketingReports To:Senior Growth Marketing ManagerPosition Summary Swain Apparel Group is seeking a creative, detail-oriented Marketing Graphic Designer to join our growing marketing team. This role is responsible for developing original visual content that supports marketing campaigns, brand initiatives, and business development efforts across digital and print platforms.A significant portion of this role will focus on designing original email marketing creative in collaboration with our Email Marketing Strategist. The ideal candidate is experienced in creating custom marketing assets from concept to completion-not simply modifying templates-and has a strong understanding of visual storytelling, branding, and

Atlanta, GA 30339 • (17.8 miles) • Full Time • 9/26/2026

Description: The Facility Service Engineer 1 is responsible for the operation and maintenance of electrical services as prescribed and will perform within the Engineering Department guidelines, to include but not limited to: performing preventive maintenance of electrical installations, preventive maintenance of HVAC systems, Preventive Maintenance of Plumbing Systems, exhibitor utility services installation for water, power, etc., utility services supply inventory checks, exhibit hall maintenance, monitoring operation techniques as to safety procedures, complying with equipment distribution requests, review required operation techniques, completing daily routine and/or event assignments as required, and such other functions and duties as required. Requirements: Experience· 2 years’ experi

Atlanta, GA 30332 • (12 miles) • Full Time • 9/26/2026

Benefits:Flexible scheduleTraining & developmentRole Summary Southeastern Cyber LLC is seeking a Digital Design / Toolchain Engineer to extend our proprietary toolchains and pipelines. The engineer will integrate various policies into an automated flow for system and hardware design. Responsibilities - Develop and extend EDA/RTL compilation tools and scripts (Python, C++, and/or Rust). - Map quantified requirements into physical standard-cell routing and logic structures. - Run synthesis, place-and-route, and area/power/timing (PPA) estimates to sweep architectural scaling limits (max model parameter count, max whitelist/blacklist size). - Interface with the Principal Investigator and Hardware SME to ensure correct RTL generation and physical implementation. Required Qualifications - B.S.

Atlanta, GA • (12.7 miles) • Full Time • 9/26/2026

This job is posted in multiple locations. When not at a client site, consultants work from their home office. Relocation is not required.Clarkston Consulting is seeking motivated, self-driven leaders who are energized by team results and interested in joining a firm that values its culture and people as its biggest strengths. Come join us as an SAP PP Senior Consultant, and in this role, you will deliver creative business solutions to our market-leading clients in the life sciences, consumer products, and retail industries.Together, we can find the answers to our clients' most challenging business problems through a combination of our industry expertise, business process knowledge, and consulting excellence.What You’ll DoAs an SAP PP Senior Consultant at Clarkston you will:Lead and guide c

Atlanta, GA • (12.7 miles) • Full Time • 9/26/2026

Company Overview: Moore Colson is a leading CPA and consulting firm in Atlanta with over 40 years of experience. Known for its collaborative, client-focused approach, Moore Colson offers a wide range of services to help businesses grow and achieve their goals. Moore Colson has an exciting internship opportunity for dynamic, motivated, and self-driven students to join ourAssurance teamin Atlanta fromJanuary - April 2028. This is an excellent chance to gain hands-on experience in auditing and public accounting, preparing you for a successful career in the field. The successful candidates will work closely with our experienced audit professionals and get exposure to various aspects of audit practice. Key Responsibilities: Preparing financial statements and related disclosures in accordance wi

Norcross, GA 30093 • (12.8 miles) • Full Time • 9/26/2026

JobDescriptionSummary:TheITFieldTicketCoordinator’sresponsibilitiesaretoreceive,validate,schedulewithcustomer,plan,andassignticketstodesignatedfieldtechniciansforpartspick-upsandhardwareITrepairservices.TheITfieldticketcoordinatorwillcommunicatedirectlywiththedesignatedfieldtechniciansresponsibleforservicesaswellaswiththeend-customersrequestingservice.TheITFieldTicketCoordinatorwillberequiredtoadheretocontractualServiceLevelAgreements(“SLAs”).KeyResponsibilities:Receive, validate, update, and end-user requests for hardware repair services via ticketing system and in compliance with contractual SLAs.Schedulerepairserviceswithend-usersviaphoneand/ore-mail.Planandassigndesignatedfieldtechnicianstoend-userserviceticketsasefficientlyaspossible.Providecustomerservicesupportviaphoneand/ore-mail.C

Atlanta, GA 30301 • (14.1 miles) • Full Time • 9/26/2026

Medical Device Quality Systems & FDA Inspection Readiness ConsultantLocation: Atlanta/Duluth, Georgia areaWork Arrangement: OnsiteDuration: Immediate start through November 2026, with potential extensionStart: ImmediatePosition OverviewWe are seeking an experienced Medical Device Quality Systems Consultant to provide hands-on support for the startup of a new Class I medical device contract manufacturing operation.The consultant will support Quality Management System (QMS) implementation, development of auditable quality and operational processes, system validation, and FDA inspection readiness. A key focus will be ensuring appropriate controls are established across production, warehousing, inventory, traceability, product hold/quarantine, release, and direct-to-consumer distribution activ

Atlanta, GA 30337 • (15.2 miles) • Full Time • 9/26/2026

You are invited to apply for Metro Supply Chain Holdings...Now accepting Open Applications.

Atlanta, GA 30346 • (15.7 miles) • Full Time • 9/26/2026

About UsAscend Aesthetic Partnersis a premier management services organization (MSO) dedicated to supporting exceptional plastic surgery and aesthetic practices for multiple states. We partner with leading surgeons and healthcare professionals to provide the operational expertise, strategic resources, and innovative solutions they need to deliver outstanding patient care while growing thriving, sustainable practices.Our comprehensive support includes human resources, finance, marketing, compliance, revenue cycle management, information technology, business development, and operational leadership. By handling the complexities of practice management, we empower our physician partners and clinical teams to focus on what matters mostdelivering exceptional patient experiences and achieving life

Atlanta, GA 30328 • (17.6 miles) • Full Time • 9/26/2026

Position Title: Senior Systems AnalystDepartment: Information ServicesReports to: Manager, Application Development and SupportLocation: Atlanta, GA (*On-Site)* During the first three (3) months of employment the incumbent will be required to work five (5) days a week onsite in the office, however thereafter they will be given the opportunity to work remotely one (1) day per week with manager approval.Summary:This position participates as a member of the team to deliver reliable, efficient and high performing technology-based solutions; assists in the design, development, testing, support, and maintenance of multiple business applications (both packaged and custom); works in a constructive and determined manner to execute the strategies and goals determined by management.Key Responsibilitie

Lawrenceville, GA • (19.8 miles) • Full Time • 9/26/2026

The Graphic Designer is responsible for following through on all customer graphics orders and will help with volume copying. In addition to effective conceptualization abilities, strong design skills, and technical expertise, the Graphic Designer must be highly collaborative by nature and must have demonstrated strengths in graphics design, project management, and communication. The ideal candidate has a Bachelor’s degree in visual communication, graphic design, or a related field; at least two years of experience in graphic design or in the print industry, and is skilled in copy-editing/proof-reading and desktop publishing. He or she must have full mastery of various software design programs including Adobe-based platforms (Acrobat, InDesign, Illustrator, and Photoshop) for both Mac and P

Marietta, GA 30067 • (20.5 miles) • Full Time • 9/26/2026

WHO WE ARE Empowering Connections, Inspiring PossibilitySageNet is a leading managed services provider specializing in connectivity, digital signage and cybersecurity. The company connects, manages and protects technologies and devices across widely distributed enterprises. SageNet’s people, processes and technologies, coupled with its collaborative approach, empowers customers to achieve their core business objectives.The company offers world-class service and support via its US-based 24/7/365 Network Operations Centers and Security Operations Centers, geographically diverse teleports, a central National Logistics Center, multiple data centers, and a nationwide field service organization.What makes SageNet unique is its Why. SageNet is passionate about Trusted Connections. This is a two-f

Alpharetta, GA 30022 • (21 miles) • Full Time • 9/26/2026

Location: Alpharetta, GA – OnsiteEmployment Type: Full-Time / ContractExperience: 10+ Years in SAP FICOBusiness-Facing Experience: Strong client-facing/business explanation experience; ideally less than 5 years in a dedicated business-facing/functional advisory capacity.Role Overview:We are looking for a highly experienced SAP FICO Business Consultant with 10+ years of hands-on SAP FICO experience who can work directly with business stakeholders and clients.The ideal candidate should have strong SAP FICO knowledge and, most importantly, the ability to understand complex technical/functional topics and explain them clearly to clients, business users, and leadership. The consultant must be confident in client meetings, requirement discussions, solution walkthroughs, and presentations.Ideal C

Alpharetta, GA • (24.1 miles) • Full Time • 9/26/2026

Role Summary DataSeers is looking for experienced ETL Developers / Data Engineers with HPCC Systems and ECL experience to build and maintain large-scale financial data pipelines.A significant portion of DataSeers' data ingestion, normalization, transformation, linking, enrichment, and analytical processing is performed using HPCC Systems and Enterprise Control Language (ECL).This is not a traditional SQL-only ETL position. You will work with large and complex financial datasets and develop ECL-based data workflows that transform disparate source data into standardized, reliable datasets used across DataSeers products.You will work with data from banks, credit unions, fintechs, payment processors, core banking systems, and other financial platforms.What You Will Do Develop, maintain, and op

Alpharetta, GA 30009 • (24.9 miles) • Full Time • 9/26/2026

Beckhoff Automation is seeking a technically motivated, customer-centric Automotive Industry Application Engineer to help shape the future of automation in the North American. In this high-impact role, you will serve as a trusted technical partner to our automotive customers, enabling their success with cutting-edge automation, control, and end-of-line test solutions.Working closely with our Automotive Industry Manager and global stakeholders, you’ll play a key role in executing our go-to-market strategy, driving the adoption of Beckhoff technologies, and contributing to growth across leading OEMs and Tier suppliers. This position blends deep technical engagement with strategic industry focus in one of Beckhoff’s most dynamic verticals.The ideal candidate thrives at the intersection of eng

Kennesaw, GA • (31.5 miles) • Full Time • 9/26/2026

Key ResponsibilitiesCreate / produce information models related to project definition or updates during the construction phase.Update information models to reflect changes occurring in the asset during the operational phase.Develop information models according to the BIM uses requested by the appointing party.Prepare BIM models for coordination with other stakeholders, following the guidelines of the project’s BIM coordinatorsand client requirements.Resolve assigned clashes and coordination issues.Report coordination issues for further review. (RFI)Prepare documentation required to meet deliverables related to both development and operational phase processes.(Panel Book & Panel Layout)Develop and maintain both graphical and non-graphical models in accordance with the project standards.Prep

Atlanta, GA 30316 • (7.3 miles) • Full Time • 9/26/2026

Description: | Full-Time | Location: Atlanta, GA | Salary: $75,000+ DOE | | Medical | Dental | Vision | 401(k) | PTO |Build Your Construction Career on Projects That Challenge You.Superior Rigging & Erecting is seeking an Assistant Project Manager to join our Atlanta team and support the planning and execution of complex crane, rigging, steel erection, and specialty construction projects.This is an opportunity for an early-career construction professional who wants more than administrative project support. You will work alongside experienced project managers, superintendents, engineers, field leaders, customers, and subcontractors while gaining hands-on exposure to the full project lifecycle.Since 1952, Superior Rigging & Erecting has built a reputation for taking on difficult work and del

Atlanta, GA • (12.7 miles) • Full Time • 9/26/2026

Build reliable data foundations that help clients turn complex data into trusted, actionable insights.We are seeking a highly motivated Data Engineering Consulting Associate to join our Data & Analytics practice. In this role, you will help clients design, build, and optimize modern data platforms that enable advanced analytics, reporting, and AI-driven decision-making.You will work alongside experienced consultants, solution architects, and client stakeholders to deliver end-to-end data engineering solutions across cloud and on-premises environments. This position offers an excellent opportunity to develop both technical expertise and consulting skills while working on large-scale digital transformation initiatives.We're anticipating future openings and are connecting now with great talen

Atlanta, GA • (12.7 miles) • Full Time • 9/26/2026

About Zipline Zipline is the world's largest and most experienced drone delivery service. We are on a mission to serve all humans equally by ensuring access to food, medicine and essential goods anytime, anywhere. We design, build, and operate the world's largest autonomous logistics system, delivering critical supplies quickly and reliably. Today, Zipline operates on four continents, makes a delivery somewhere in the world every 30 seconds, and has completed millions of deliveries to date, including blood, vaccines, medical supplies, food, and retail products.Our customers include the world's largest and most prominent healthcare systems, governments, retailers, restaurants and global businesses who rely on us to save lives, reduce emissions, increase economic opportunity, and provide de

Atlanta, GA • (12.7 miles) • Full Time • 9/26/2026

COMPANY OVERVIEWWith over 37 years of experience, Peacock Partnership, Inc. is an award-winning full-service design and consulting firm with a primary focus on the healthcare industry. We offer our clients the opportunity for a single-source of responsibility from the start to finish of their project. We incorporate a comprehensive range of services, including master planning, architecture, interiors, facility consulting, and development management.POSITION SUMMARYWe are seeking a Senior Healthcare Architect with 15+ years of professional experience to act as a technical leader, master planner, and client partner for complex healthcare infrastructure projects. In this role, you will champion the design, execution, and regulatory approval of large-scale clinical environments, hospital expan

College Park, GA • (16.1 miles) • Full Time • 9/26/2026

Title: Quality Assurance AnalystCompensation: $60-72kLocation: College Park, GeorgiaBenefits: Medical, Dental, Vision, FSA/HSAAbout the Company:Nitro is a Brazilian multinational that marked 90 years in business in 2025, tracing its roots back to its founding in 1935. The company is recognized as a pioneer in Brazil's modern chemical industry and is one of the country's largest suppliers of nitrocellulose. Nitro serves clients in more than 70 countries and operates in Brazil, Uruguay, the United States, and Europe. Since 2019, the company has expanded into agribusiness specialty products through the acquisition of several units, broadening its portfolio to serve all of Brazil. In recent years, Nitro has seen strong growth, with revenue increasing more than 30% annually and sales growth exc

Atlanta, GA 30338 • (16.4 miles) • Full Time • 9/26/2026

SAP Enterprise ArchitectOur client is a global technology, consulting, and business-services company has been recognized by major organizations for its workplace culture, management consulting, sustainability, ethical business practices, innovation, and talent development. Recent accolades include recognition as one of the World’s Best Employers by Forbes, one of the World’s Most Ethical Companies by Ethisphere, and one of Forbes’ World’s Best Management Consulting Firms. It has also received workplace, sustainability, and employee-development awards from organizations such as Newsweek, TIME, CDP, Frost & Sullivan, and Brandon Hall Group.Position Overview Title: SAP Enterprise Architect Location: Atlanta, GA Duration: FT, Direct-hire Role PurposeLead the enterprise architecture for a large

Atlanta, GA 30339 • (17.8 miles) • Full Time • 9/26/2026

Senior Enterprise Architect Employment Type: Full-timeReports To: VP, Services Portfolio & GTMLocation: Hybrid – Atlanta, GA (WFH flexibility)Travel: ~25% (client meetings, workshops, assessments, industry events).Role Summary We are seeking a Senior Enterprise Architect to serve as a strategic technical advisor across the full customer lifecycle. This role takes a holistic view of a client’s overall technology environment enterprise infrastructure, public cloud, digital workspace, security, and business applications and translates business strategy, risk, and compliance drivers into currentstate assessments, targetstate architectures, and actionable transformation roadmaps aligned to ivision’s services portfolio and our ASSESS ARCHITECT TRANSFORM OPERATE delivery lifecycle.The ideal candi

Hampton, GA 30228 • (23 miles) • Full Time • 9/26/2026

Job Summary: The Application Engineer I – Power Systems is responsible for supporting the technical development, application, design, and proposal of medium-voltage and high-voltage reactive power compensation and power quality equipment. This role works closely with Customers, Sales, Engineering, Project Management, Manufacturing, and Purchasing to review project specifications, develop compliant technical solutions, prepare proposal documents, and support projects from the quotation stage through order execution. The Application Engineer will serve as a technical advisor and product advocate for the Power System Solutions Division. The role requires the ability to identify technical risks and exceptions to customer specifications, develop equipment configurations, prepare budgets and bil

Suwanee, GA • (23.8 miles) • Full Time • 9/26/2026

Job Title: Test TechnicianSuwanee, GA Pay: $19-$25/HourShift: 6a-5:30PMJob DescriptionThe Test Technician performs routine and specialized electrical tests on transformers, power metering products, power distribution units, and other integrated systems to verify that all products meet defined specifications. This role troubleshoots and resolves manufacturing and design issues in a timely manner to support product quality and customer satisfaction, while contributing to continuous improvement in processes and practices.ResponsibilitiesPerform routine and special electrical tests on transformers, power metering products, power distribution units, and other integrated systems to ensure products meet specifications.Assist in the assembly of products by reading and following electrical schemati

Atlanta, GA 30316 • (7.3 miles) • Full Time • 9/25/2026

As a Senior HVAC Application Engineer, you will be tasked with the development of control system engineering and standard application software selection for all assigned projects. The system design will be in accordance with the project estimates, the account representative’s special instructions, and in compliance with the project design documents (plans and specifications). The system design will consist of submittal and installation documents, including: overall control network architecture, detailed wiring termination sheets, parts lists, equipment schedules, sequences of operation, application programming checklists, and point-to-point control system checkout lists. The Senior Application Engineer will be responsible for equipment selection, proper sizing, capacity calculations, and f

Atlanta, GA 30329 • (9.7 miles) • Full Time • 9/25/2026

SENIOR SYSTEMS ADMINISTRATOR:Ensures the stable operation of the in-house computer software systems and network connections. This includes planning, developing, installing, configuring, maintaining, supporting, and optimizing all network software and communication links. Analyzes and resolves end user software program and connectivity issues. Provides end user training. Provide recommendations on technology direction to align with business vision. Will be required to provide both local and remote maintenance support to various operational systems deployed at more than one location. Support includes general maintenance, upgrades, and new installs of servers and applications. Applies advanced technical knowledge of application networking, including load balancing applications, and ensuring f

Atlanta, GA • (12.7 miles) • Full Time • 9/25/2026

The PositionCallRail is looking for an Atlanta-based Senior Software Engineer to help accelerate the growth and product development of our platform. We're looking for someone with experience in server-side web application development using Ruby on Rails, and some level of comfort occasionally working in the frontend with Angular.What You'll DoDeliver incredible products. You'll work from product strategy and customer context to define and scope your own work. We expect you to close the loop between engineering and outcomes – not just ship features, but reason about whether you're building the right thing. You'll help contribute to this platform as a product-minded Engineer focused on delivering the best products possible.Collaborate. We collaborate with other Engineers, Product Managers, a

Atlanta, GA • (12.7 miles) • Full Time • 9/25/2026

About MantisWe help organizations improve how their buildings perform by bringing together energy, facility operations, and sustainability into one connected approach. At Mantis, our teams work across the full lifecycle of a facilityfrom planning and design to field execution and long-term asset managementacross commercial and industrial portfolios, data centers, and complex mechanical systems.Our work spans four core areas: Building Controls, Energy Efficiency, Energy Advisory, and Facility Managementcovering HVAC/mechanical optimization, BMS/BAS and EPMS controls, lighting system upgrades, energy brokerage, roofing and building envelope assessments, construction management, and more.Whether you’re in sales, engineering, construction/project management, field operations, corporate, or tec

Atlanta, GA • (12.7 miles) • Full Time • 9/25/2026

Capgemini is at the forefront of innovation, integrating AI technologies to enhance customer experience and streamline operations.We are seeking an experienced and innovative Verint AI Software Engineer to join our team supporting a premier U.S. Property & Casualty insurance carrier. This role is ideal for a technologist with deep expertise in Verint AI and a strong understanding of enterprise voice ecosystems, including CISCO, Google Cloud, and NICE. You will be instrumental in designing, developing, and optimizing AI-driven solutions that enhance customer experience, operational efficiency, and digital engagement. In this role, you will work closely with cross-functional teams to design, develop, and deploy AI-driven solutions that leverage Verint AI technology to address complex busines

Atlanta, GA • (12.7 miles) • Full Time • 9/25/2026

About Markup AIMarkup AI is pioneering the AI content governance category with the industry's first Content Guardian AgentsAI-powered agents that automatically scan, score, and rewrite content to ensure it meets brand, compliance, terminology, and quality standards before it goes live. Purpose-built for AI-first marketing and content teams, Markup AI integrates directly into LLMs, CMS platforms, and enterprise workflows through its API- and MCP-first architecture, giving organizations the confidence to scale AI-generated content without sacrificing quality, consistency, or trust. Backed by decades of expertise in enterprise content governance, Markup AI is helping leading global brands publish faster, safer, and with confidence.Eligible candidates must reside in one of the following states