Atlanta, GA • (35.1 miles) • Full Time • 9/15/2026

Senior Electrical Project ManagerLocation: Atlanta, GA | Fully onsiteCompensation: Up to $170,000 base salary, based on experienceSchedule: Six 10-hour shifts per week during active project executionAbout the RoleWorkspire is partnering with an established specialty contractor supporting complex electrical and infrastructure projects across the United States. The organization is expanding its mission-critical construction capabilities and is seeking a proven project leader to help deliver a large-scale greenfield data center development.The Senior Electrical Project Manager will own the electrical scope from early field mobilization through commissioning and energization. Reporting to project leadership, this person will be responsible for cost, schedule, quality, safety, documentation, an

Atlanta, GA • (35.1 miles) • Full Time • 9/15/2026

At PEARCE, we've got a career for you!Pearce is a leading technology-enabled provider of asset management solutions for mission-critical electromechanical infrastructure throughout North America. Pearce provides technical maintenance, repair, operations, and engineering services for uninterruptible power supply (UPS) systems, backup power generators, battery energy storage systems (BESS), critical cooling systems, and other electrical and mechanical infrastructure across end markets such as renewable energy, telecom, and data centers. Founded in 1998, Pearce has more than 4,000 employees and 28 locations across the U.S. Pearce is a wholly owned subsidiary of CBRE Group, Inc., the world's largest commercial real estate services and investment firm. To learn more about Pearce visit http://ww

Atlanta, GA • (35.1 miles) • Full Time • 9/2/2026

Jira Lead Admin Employment Type: Full-Time, Mid Level Department: Information Technology CGS is seeking a talented Jira Lead Administrator who is passionate about driving transformation in the federal IT domain to join our growing team of technology and software consulting professionals. Strong candidates will have a desire to drive change in the federal space by developing executable strategies, implementing new technologies, streamlining processes, and improving the delivery of mission value delivery through new practices and tools. CGS brings motivated, highly skilled, and creative people together to solve the government’s most dynamic problems with cutting-edge technology. To carry out our mission, we are seeking candidates who are excited to contribute to government innovation, appre

Atlanta, GA • (35.1 miles) • Full Time • 9/27/2026

Our client, Hawthorne House, is hiring for the Furnishings Project Coordinator. This position supports the furnishings and lighting projects from proposal through procurement, delivery, and installation.This is not a design position. It is a highly organized, client-facing coordination role with a strong emphasis on communication, administration, scheduling, documentation, procurement follow-through, and keeping multiple projects moving accurately and on time.Experience in the interior design, furnishings, decorative lighting, procurement, or related trade industry is strongly preferred.This is a hybrid position, with candidates in the Athens or Atlanta area preferred. The role will combine remote work with in-person collaboration, client meetings and occasional travel to the Hawthorne Hou

Atlanta, GA 30319 • (42.3 miles) • Full Time • 9/27/2026

About EskewDumezRippleEskewDumezRipple (EDR) is a nationally recognized group of architects, designers, and thinkers operating within the fields of architecture, interior design, research, and urban strategies with studios in New Orleans and Washington DC.Our studio itself is a diverse group of people from all over the world, a resonant gathering of experiences and expertise. We are curious and determined. We nurture a culture that encourages a spirit of collaboration and attracts inquisitive people.Our work unfolds at every scale, harmoniously integrating interiors and buildings with neighborhoods and communities.About the JobWe are currently seeking a Project Architect with 8+ years of experience to join our studio in New Orleans, LA. This role will contribute to a variety of projects ac

Atlanta, GA 30339 • (42.8 miles) • Full Time • 9/27/2026

Description: ECI Group is currently hiring a Director, IT Operations & Strategy to serve as the head of our technology department, with full ownership of both the strategic direction and day-to-day operations of technology across the organization. This is not a pure strategy role, nor is it a pure operations role. You will set the technology vision and own day-one execution. You will be equally comfortable presenting a three-year technology roadmap to the executive team and rolling up your sleeves to resolve a critical system issue. We are looking for a proven leader who understands that at a dynamic, growth-oriented company, great strategy and great operations are inseparable. If you are energized by building something meaningful, leading a team, and leaving the technology environment mea

Smyrna, GA • (43.3 miles) • Full Time • 9/27/2026

JOB TITLE: Service EngineerREPORT TO: Service ManagerFLSA STATUS: Non-ExemptRESPONSIBILITIES:Responsibilities to include the following. Other duties may be assigned from time to time at the Company’s sole discretion.Utilize professional knowledge and experience to maintain the Company's safety standards in accordance with OSHA and state regulations when working on equipment. while working with vitality and disciplineProvide on-site installation, validation and commissioning of machinery/mold as well as diagnosing and repairing existing machinery/mold in the field, in accordance with the Company standards and in line with professional judgment. Pursue customer satisfactionExercise independent discretion to develop and maintain good customer relations in the performance of duties, while main

Morrow, GA 30260 • (22.2 miles) • Full Time • 9/27/2026

Food Manufacturing- Quality Assurance SupervisorThe Food Safety Quality Assurance Supervisor is responsible for developing, administering and maintaining Food Safety and Quality programs that assure the production of high quality, safe products.Job Functions:Supervise the on-line quality assurance technicians to assure compliance to all company, customer quality, and food safety requirements.Effectively coach and drive performance improvements of QA Assistant Supervisors, QA Technicians, and Raw Material Inspectors.Address performance issues of QA personnel using Chiquita HR guidelines.Audit compliance to food safety requirements.Carry out root cause analysis and drive sustained improvement at the production level.Instill a culture of operational discipline, accuracy, and compliance.Prepar

Atlanta, GA • (35.1 miles) • Full Time • 9/27/2026

At Coinme, we're redefining access to financial services in a digital world. By combining the cutting-edge power of blockchain technology with everyday simplicity, we make digital currencies accessible and usable for all.As the world's largest network of cryptocurrency kiosks with over 40,000 locations nationwide, we're breaking down barriers to crypto adoption through our seamless mobile app, secure digital wallet, and DeFi integrations. Beyond our consumer offerings, we're also the infrastructure powering the crypto revolution for businesses.Through our enterprise Crypto-as-a-Service (CaaS) platform, we enable businesses to launch crypto capabilities in weeks, not months. Our modular, API-first infrastructure provides everything from KYC and payment processing to liquidity and custody so

Atlanta, GA • (35.1 miles) • Full Time • 9/27/2026

Why Work at SMA AmericaPower the future. Build your career at SMA America.As the U.S. subsidiary of SMA Solar Technology AG, we have been at the forefront of solar inverter technology since 1981, developing solutions that make photovoltaic power plants simpler, more reliable, safer, and more cost effective. Headquartered in Rocklin, California, SMA America has spent more than two decades helping homes, businesses, and utilities across the country generate clean, reliable power. We are the only inverter manufacturer in the world offering solutions for every system size, from residential rooftops to large scale utility plants, backed by more than 1,500 patents and a presence in over 190 countries.Innovation is only part of the story. We invest in our people, create room to grow, challenge co

Atlanta, GA • (35.1 miles) • Full Time • 9/27/2026

OUR COMPANY:EOS IT Solutions is a Global Technology and Logistics company, providing Collaboration and Business IT Support services to some of the world's largest industry leaders, delivering forward-thinking solutions based on multi-domain architecture. Customer satisfaction and commitment to superior quality of service are our top business priorities, along with investing in and supporting our partners and employees.We are a true International IT provider and are proud to deliver our services through global simplicity with trusted transparency.WHAT YOU WILL DO:As a Fiber Optical Splicing Technician, you will be responsible for the installation, splicing, testing, troubleshooting, and maintenance of fiber optic cabling infrastructure. This hybrid role combines the practical skills of an I

Atlanta, GA • (35.1 miles) • Full Time • 9/27/2026

S/4HANA Transformation & Integration Lead Atlanta, Georgia, USA | Full-time | On-siteMaxIT Consulting – Max Corporate Group is looking for a highly experienced S/4HANA Transformation & Integration Lead to support a large-scale enterprise transformation and global SAP rollout program within a major organization in the manufacturing sector.This is a senior techno-functional architecture role requiring broad ownership across SAP S/4HANA, Salesforce, integrations, data, security, enterprise applications, and business processes. The selected professional will work closely with business and technology leadership to define and govern the end-to-end target architecture.About the Role You will lead enterprise and solution architecture across a complex SAP transformation landscape, ensuring alignmen

Atlanta, GA 30361 • (36.5 miles) • Full Time • 9/27/2026

OBJECTIVE:Executing high level project management support to CEC's top customer accounts. Providing high level communication both internally and externally to meet customer expectations while having CEC's best interests in mind; proactively driving projects to be completed on time, within budget and by specifications.CORE RESPONSIBILITIES include, but are not limited to the following:· Project Notification:o Ensures customer is contacted within 48 hours of project Award.o Reviews overall project objectives and timelines with customer and establishes ongoing communication strategy.o Ensures all required project information has been provided to Operations from Sales and Engineering.o Assigns project related tasks within ConnectWise in relation to project timelines.· Project Information Revie

Fayetteville, GA 30214 • (19.5 miles) • Full Time • 9/26/2026

Job Title: Data Center TechnicianShift: Two Shifts Available. Day and Night ShiftJob Overview:We are seeking a skilled and reliable Data Technician to join our team. The primary responsibilities for this role will include building data cabinets, racking, and stacking in a data center environment. The ideal candidate will have at least 6 months of prior experience in data center rack and stack work and will be comfortable working in a fast-paced, technical environment. This is an excellent opportunity to be part of a high-impact project while gaining hands-on experience in the data center industry.Key Responsibilities:Rack and Stack: Install servers, switches, routers, and other hardware into server racks and cabinets. Ensure proper cable management and secure all equipment.Data Cabinet Set

Atlanta, GA 30339 • (42.8 miles) • Full Time • 9/26/2026

Description: The Facility Service Engineer 1 is responsible for the operation and maintenance of electrical services as prescribed and will perform within the Engineering Department guidelines, to include but not limited to: performing preventive maintenance of electrical installations, preventive maintenance of HVAC systems, Preventive Maintenance of Plumbing Systems, exhibitor utility services installation for water, power, etc., utility services supply inventory checks, exhibit hall maintenance, monitoring operation techniques as to safety procedures, complying with equipment distribution requests, review required operation techniques, completing daily routine and/or event assignments as required, and such other functions and duties as required. Requirements: Experience· 2 years’ experi

Atlanta, GA 30337 • (27.5 miles) • Full Time • 9/26/2026

You are invited to apply for Metro Supply Chain Holdings...Now accepting Open Applications.

Atlanta, GA • (35.1 miles) • Full Time • 9/26/2026

Description:On-site in Atlanta, GA (Midtown) + up to 50% Travel in the field Our client, a leader in their industry, has an excellent opportunity for a Systems Integration Engineer to work on a 6+ month contract position with potential for extension in Atlanta, GA (Midtown). This role requires up to 50% travel, with approved travel expenses reimbursed.Due to client requirements, applicants must be willing and able to work on a W2 basis. For our W2 consultants, we offer a great benefits package that includes Medical, Dental, and Vision benefits, 401k with company matching, and life insurance.Rate: $60-$70/hr W-2 plus approved travel expensesResponsibilities:• Design and integrate systems spanning electrical, embedded, software, networking, sensing, AI, and field infrastructure.• Develop and

Atlanta, GA • (35.1 miles) • Full Time • 9/26/2026

Company Description CapTech is a technology consulting firm dedicated to helping clients achieve their business objectives through innovative technology solutions. With a commitment to excellence and collaboration, CapTech partners with leading companies to deliver digital transformation, software development, and technology consulting services.Job Description Consulting at CapTechPartner with clients on crossfunctional, teambased projects to deliver scalable Salesforce solutions across the full Software Development Lifecycle (SDLC) using Agile methodologiesServe as a trusted technical advisor, managing architectural scope while aligning technical solutions with business goalsCommunicate effectively with both technical and nontechnical stakeholders, setting clear expectations and guiding d

Atlanta, GA • (35.1 miles) • Full Time • 9/26/2026

Company Overview: Moore Colson is a leading CPA and consulting firm in Atlanta with over 40 years of experience. Known for its collaborative, client-focused approach, Moore Colson offers a wide range of services to help businesses grow and achieve their goals. Moore Colson has an exciting internship opportunity for dynamic, motivated, and self-driven students to join ourAssurance teamin Atlanta fromJanuary - April 2028. This is an excellent chance to gain hands-on experience in auditing and public accounting, preparing you for a successful career in the field. The successful candidates will work closely with our experienced audit professionals and get exposure to various aspects of audit practice. Key Responsibilities: Preparing financial statements and related disclosures in accordance wi

Atlanta, GA • (35.1 miles) • Full Time • 9/26/2026

Welcome to the future of cloud networking and security!Cato Networks is the first company to converge enterprise networking and security into one centralized and global service that is delivered by cloud. It is led by networking and security pioneer Shlomo Kramer (Check Point, Imperva) and early investor (Palo Alto Networks, Exabeam, Trusteer and more). Cato's unique technology inspired a brand-new product category, later named "SASE" by Gartner and a market expected to reach $28.5 billion by 2028. This is your opportunity to get on the rocket ship and join a company that is building a cutting-edge enterprise network and secure cloud platform, and is on a fast track to becoming the worldwide market leader – don't miss it!As Technical Enablement Team Lead, you will lead the strategy, execut

Atlanta, GA • (35.1 miles) • Full Time • 9/26/2026

This job is posted in multiple locations. When not at a client site, consultants work from their home office. Relocation is not required.Clarkston Consulting is seeking motivated, self-driven leaders who are energized by team results and interested in joining a firm that values its culture and people as its biggest strengths. Come join us as an SAP PP Senior Consultant, and in this role, you will deliver creative business solutions to our market-leading clients in the life sciences, consumer products, and retail industries.Together, we can find the answers to our clients' most challenging business problems through a combination of our industry expertise, business process knowledge, and consulting excellence.What You’ll DoAs an SAP PP Senior Consultant at Clarkston you will:Lead and guide c

Atlanta, GA • (35.1 miles) • Full Time • 9/26/2026

Mobile Applications Developer IIExpert Technical Solutions is seeking a skilledMobile Applications Developer IIfor one of our premier, industry leading clients inAtlanta, GA 30076 (Roswell). This person willresponsible for the development and maintenance of ourclient’ssuite of mobile applications. They will collaborate with cross-functional teams to design, develop, and deliver high-quality mobile applications. The candidate should have experience in developing applications for iOS and/or Android platforms. They should be able to work independently and as part of a team.This is a Permanent (Hybrid –4days onsite inIndianapolis, IN 46256) opportunity offering excellent pay, benefits, and growth potential.Primary Duties and Responsibilities:Design and develop mobile applications for the Andro

Atlanta, GA • (35.1 miles) • Full Time • 9/26/2026

Strength in Trust OneTrust's mission is to enable innovation through the responsible use of data and AI. We believe that ensuring data is trusted shouldn't slow teams downit should accelerate what's possible. This led us to develop the first technology platform for responsible data use in 2016. Today, with AI representing the latest and most impactful expansion of data yet, OneTrust is once again redefining what responsible innovation looks like. OneTrust, the AIReady Governance Platform, unifies regulatory intelligence, automation, and connected governance workflows so businesses can continue to move at the speed of AI while ensuring good governance to prevent data misuse at scale. Trusted by thousands of organizations worldwide, OneTrust is shaping the future where trusted data becomes

Atlanta, GA • (35.1 miles) • Full Time • 9/26/2026

About YouAre you a client focused construction leader who actively works to ensure project profitability? Do you have a 'can do' attitude and an unwavering commitment to excellence? If this sounds like you, then you should mull over a career with Mullins Mechanical.We're looking for an experienced Project Executive to join our team. As a Project Executive at Mullins, you will be a key player in managing and guiding construction projects from inception to completion. Your responsibilities will include leading mega projects while mentoring and advising Senior Project Managers, Project Managers, and Assistant Project Managers, overseeing high-profile and complex projects, and developing strong client relationships. Your role will encompass various aspects from project setup to closeout, and y

Atlanta, GA 30332 • (35.9 miles) • Full Time • 9/26/2026

Benefits:Flexible scheduleTraining & developmentRole Summary Southeastern Cyber LLC is seeking a Digital Design / Toolchain Engineer to extend our proprietary toolchains and pipelines. The engineer will integrate various policies into an automated flow for system and hardware design. Responsibilities - Develop and extend EDA/RTL compilation tools and scripts (Python, C++, and/or Rust). - Map quantified requirements into physical standard-cell routing and logic structures. - Run synthesis, place-and-route, and area/power/timing (PPA) estimates to sweep architectural scaling limits (max model parameter count, max whitelist/blacklist size). - Interface with the Principal Investigator and Hardware SME to ensure correct RTL generation and physical implementation. Required Qualifications - B.S.

Atlanta, GA 30305 • (39.7 miles) • Full Time • 9/26/2026

Assistant Project Manager – Commercial Construction | Atlanta, GeorgiaReady to take the next step in your construction management career? We're looking for an Assistant Project Manager to support commercial construction projects and learn alongside experienced industry professionals.About the CompanyOrdner Construction has spent nearly four decades building lasting relationships through quality commercial construction services. The company offers exposure to a wide variety of project types while providing opportunities for professional growth and advancement.What You'll DoManage RFIs, submittals, and project documentationAssist with scheduling, procurement, and cost trackingCoordinate subcontractors and vendorsSupport project managers throughout the project lifecycleHelp ensure successful

Tucker, GA 30084 • (40.7 miles) • Full Time • 9/26/2026

Senior Energy Systems Analyst III - IVDesign, Support, and Improve Critical Energy Billing and Settlement SystemsGeorgia System Operations Corporation (GSOC) is seeking a Senior Energy Systems Analyst to provide functional and technical ownership of the applications, data processes, controls, and business rules that support accurate and timely Member billing, energy settlements, contract calculations, and related reporting across the Family of Companies.This role combines business systems analysis, application development, data analytics, and technical leadership to ensure critical energy billing and settlement solutions remain accurate, reliable, scalable, and audit-ready.The Senior Energy Systems Analyst designs, develops, supports, and improves solutions using Excel/VBA, SQL, Microsoft

Atlanta, GA 30301 • (41.2 miles) • Full Time • 9/26/2026

Medical Device Quality Systems & FDA Inspection Readiness ConsultantLocation: Atlanta/Duluth, Georgia areaWork Arrangement: OnsiteDuration: Immediate start through November 2026, with potential extensionStart: ImmediatePosition OverviewWe are seeking an experienced Medical Device Quality Systems Consultant to provide hands-on support for the startup of a new Class I medical device contract manufacturing operation.The consultant will support Quality Management System (QMS) implementation, development of auditable quality and operational processes, system validation, and FDA inspection readiness. A key focus will be ensuring appropriate controls are established across production, warehousing, inventory, traceability, product hold/quarantine, release, and direct-to-consumer distribution activ

Atlanta, GA 30339 • (42.8 miles) • Full Time • 9/26/2026

Strategic Implementation Manager opportunity with Connexure in Atlanta, Georgia. Connexure is a software company fully dedicated to serving the self-funded medical benefits ecosystem. Our software helps stop-loss carriers, brokers, and third-party administrators quote, underwrite, and administer stop-loss policies. Our mission is to unify the self-funded medical ecosystem through integrated technologies, artificial intelligence, processes, and data insights. Our leadership team believes in a customer-centric approach to driving value and creating a network effect where the software becomes value-additive through stakeholder interoperability. We are looking for talented and motivated individuals who align with our vision and will support the next phase of growth.The Implementation Manager o

Norcross, GA 30093 • (44.7 miles) • Full Time • 9/26/2026

JobDescriptionSummary:TheITFieldTicketCoordinator’sresponsibilitiesaretoreceive,validate,schedulewithcustomer,plan,andassignticketstodesignatedfieldtechniciansforpartspick-upsandhardwareITrepairservices.TheITfieldticketcoordinatorwillcommunicatedirectlywiththedesignatedfieldtechniciansresponsibleforservicesaswellaswiththeend-customersrequestingservice.TheITFieldTicketCoordinatorwillberequiredtoadheretocontractualServiceLevelAgreements(“SLAs”).KeyResponsibilities:Receive, validate, update, and end-user requests for hardware repair services via ticketing system and in compliance with contractual SLAs.Schedulerepairserviceswithend-usersviaphoneand/ore-mail.Planandassigndesignatedfieldtechnicianstoend-userserviceticketsasefficientlyaspossible.Providecustomerservicesupportviaphoneand/ore-mail.C

Atlanta, GA 30320 • (26.9 miles) • Full Time • 9/26/2026

Our client is seeking a skilled Machinist/Programmer to join their team in Albany, Georgia. The successful candidate will be responsible for CNC programming for mill and lathe parts, creating program setup sheets, aiding in fixturing, recommending tooling, and training others in CNC G-code programming. A key aspect of this role is working on time-saving projects to enhance shop efficiency while being hands-on with team members on the shop floor. Responsibilities:CNC programming for mills and lathesCreation of program setup sheetsFixturing and work holding assistanceTooling recommendations for machining operationsCNC G-code programming training for team membersEquipment scheduling and maintenance collaborationMetrology tool utilization for part measurementComplex setups and programming for

Atlanta, GA • (35.1 miles) • Full Time • 9/26/2026

FinQuery stands at the forefront of accounting automation, driven by a deep specialty in contract-driven accounting. Our AI-enabled platform transforms how controllers and finance teams operate, seamlessly managing and accounting for the complex financial contractslike leases, prepaids, and accrualsthat are the backbone of modern business. We are not just a software provider; we are the unified subledger that eliminates time-intensive, error-prone technical accounting workflows, ensuring financial reports are accurate and empowering our customers to focus on strategic, high-value tasks. FinQuery is the global leader in lease accounting (as recognized onG2.com) and serve more than 8,500 customers worldwide. Our growth trajectory has been consistently validated by the Inc 5000, which has re

Atlanta, GA 30305 • (39.7 miles) • Full Time • 9/26/2026

Job Tite : Oracle SCM Cloud FunctionalDuration : Long TermLocation : Atlanta, GALead and support the implementation of Oracle Cloud SCM modules.Provide expertise in configuring and customizing Oracle Cloud SCM to meet business requirements.Serve as the primary point of contact for application related issues and provide troubleshooting and support.Collaborate with cross-functional teams to ensure successful integration of Oracle Cloud SCM with other systems.Expertise in Order management, Procurement and InventoryLead and participate in system testing and end-user training.Provide support and troubleshooting assistance to end-users.Stay up-to-date on Oracle Cloud Financials functionality and updatesProvide Technical/Functional support to Business Development sales pursuits.

Hampton, GA 30228 • (9.5 miles) • Full Time • 9/26/2026

Job Summary: The Application Engineer I – Power Systems is responsible for supporting the technical development, application, design, and proposal of medium-voltage and high-voltage reactive power compensation and power quality equipment. This role works closely with Customers, Sales, Engineering, Project Management, Manufacturing, and Purchasing to review project specifications, develop compliant technical solutions, prepare proposal documents, and support projects from the quotation stage through order execution. The Application Engineer will serve as a technical advisor and product advocate for the Power System Solutions Division. The role requires the ability to identify technical risks and exceptions to customer specifications, develop equipment configurations, prepare budgets and bil

College Park, GA • (27.5 miles) • Full Time • 9/26/2026

Title: Quality Assurance AnalystCompensation: $60-72kLocation: College Park, GeorgiaBenefits: Medical, Dental, Vision, FSA/HSAAbout the Company:Nitro is a Brazilian multinational that marked 90 years in business in 2025, tracing its roots back to its founding in 1935. The company is recognized as a pioneer in Brazil's modern chemical industry and is one of the country's largest suppliers of nitrocellulose. Nitro serves clients in more than 70 countries and operates in Brazil, Uruguay, the United States, and Europe. Since 2019, the company has expanded into agribusiness specialty products through the acquisition of several units, broadening its portfolio to serve all of Brazil. In recent years, Nitro has seen strong growth, with revenue increasing more than 30% annually and sales growth exc

Atlanta, GA 30316 • (30.9 miles) • Full Time • 9/26/2026

Description: | Full-Time | Location: Atlanta, GA | Salary: $75,000+ DOE | | Medical | Dental | Vision | 401(k) | PTO |Build Your Construction Career on Projects That Challenge You.Superior Rigging & Erecting is seeking an Assistant Project Manager to join our Atlanta team and support the planning and execution of complex crane, rigging, steel erection, and specialty construction projects.This is an opportunity for an early-career construction professional who wants more than administrative project support. You will work alongside experienced project managers, superintendents, engineers, field leaders, customers, and subcontractors while gaining hands-on exposure to the full project lifecycle.Since 1952, Superior Rigging & Erecting has built a reputation for taking on difficult work and del

Decatur, GA 30035 • (32 miles) • Full Time • 9/26/2026

Raba Kistner, Inc. is a premier Engineering Consulting and Program Management firm. Our purpose is to build a better and more sustainable world for our employees, their families, our clients, and the communities we serve. Our Core Values are:Community “We care for our communities”Integrity “We act with integrity”Passion “We infuse passion into everything we do”Quality “We believe quality comes from a culture of innovation and continuous improvement”Growth “We dedicate ourselves to personal and business growth”Raba Kistner is seeking a dependable Project Manger IIto join our Infrastructure team in Decatur, GA. Under direction, responsible for all areas or project operations, as determined by the size and nature of the project, including construction inspection and material testing operation

Atlanta, GA • (35.1 miles) • Full Time • 9/26/2026

Build reliable data foundations that help clients turn complex data into trusted, actionable insights.We are seeking a highly motivated Data Engineering Consulting Associate to join our Data & Analytics practice. In this role, you will help clients design, build, and optimize modern data platforms that enable advanced analytics, reporting, and AI-driven decision-making.You will work alongside experienced consultants, solution architects, and client stakeholders to deliver end-to-end data engineering solutions across cloud and on-premises environments. This position offers an excellent opportunity to develop both technical expertise and consulting skills while working on large-scale digital transformation initiatives.We're anticipating future openings and are connecting now with great talen

Atlanta, GA • (35.1 miles) • Full Time • 9/26/2026

Position: React Native Technical LeadLocation: Atlanta, GA – OnsiteDuration: Long TermRole: Onsite Technical Lead – TSC Kiosk ProjectJob Description:We are seeking a React Native Technical Lead to provide hands-on technical leadership for a consumer-facing mobile application supporting iOS and Android. The role will focus on application stability, performance, security, production support, architecture, and feature delivery.Key Responsibilities:Lead the technical design, development, code reviews, troubleshooting, and release readiness of the React Native application.Own mobile architecture, technical roadmap, coding standards, reusable components, dependencies, and technical debt.Drive production support, incident triage, root-cause analysis, performance optimization, and application stab

Atlanta, GA • (35.1 miles) • Full Time • 9/26/2026

COMPANY OVERVIEWWith over 37 years of experience, Peacock Partnership, Inc. is an award-winning full-service design and consulting firm with a primary focus on the healthcare industry. We offer our clients the opportunity for a single-source of responsibility from the start to finish of their project. We incorporate a comprehensive range of services, including master planning, architecture, interiors, facility consulting, and development management.POSITION SUMMARYWe are seeking a Senior Healthcare Architect with 15+ years of professional experience to act as a technical leader, master planner, and client partner for complex healthcare infrastructure projects. In this role, you will champion the design, execution, and regulatory approval of large-scale clinical environments, hospital expan

Atlanta, GA • (35.1 miles) • Full Time • 9/26/2026

About Zipline Zipline is the world's largest and most experienced drone delivery service. We are on a mission to serve all humans equally by ensuring access to food, medicine and essential goods anytime, anywhere. We design, build, and operate the world's largest autonomous logistics system, delivering critical supplies quickly and reliably. Today, Zipline operates on four continents, makes a delivery somewhere in the world every 30 seconds, and has completed millions of deliveries to date, including blood, vaccines, medical supplies, food, and retail products.Our customers include the world's largest and most prominent healthcare systems, governments, retailers, restaurants and global businesses who rely on us to save lives, reduce emissions, increase economic opportunity, and provide de