Please Accept our Privacy Policy
Ace Electric
Kennesaw, GA 30144 • (40.3 miles) • Full Time • 9/20/2026
Project Manager – Electrical Contractor: Mission Critical | Data Centers | Hyperscale WorkKennesaw, GeorgiaBuild the Infrastructure Behind the World’s Most Critical OperationsAce Electric is hiring Project Managers to lead large-scale electrical construction projects across the U.S., with a primary focus ondata center construction and other hyperscale mission-critical projects.This role is based out of our Kennesaw, Georgia division, with flexibility to:Work from Jackson with routine travel to active projects, orBe embedded on-site as a Project ManagerIf you’re wired for pace, ownership, and high-impact workthis is where you step up.What You’ll OwnFull lifecycle management of multi-million-dollar electrical projectsProject financials: forecasting, cost control, and profitabilityCoordinatioWorkspire
Atlanta, GA • (41.1 miles) • Full Time • 9/15/2026
Senior Electrical Project ManagerLocation: Atlanta, GA | Fully onsiteCompensation: Up to $170,000 base salary, based on experienceSchedule: Six 10-hour shifts per week during active project executionAbout the RoleWorkspire is partnering with an established specialty contractor supporting complex electrical and infrastructure projects across the United States. The organization is expanding its mission-critical construction capabilities and is seeking a proven project leader to help deliver a large-scale greenfield data center development.The Senior Electrical Project Manager will own the electrical scope from early field mobilization through commissioning and energization. Reporting to project leadership, this person will be responsible for cost, schedule, quality, safety, documentation, anPearce Services
Atlanta, GA • (41.1 miles) • Full Time • 9/15/2026
At PEARCE, we've got a career for you!Pearce is a leading technology-enabled provider of asset management solutions for mission-critical electromechanical infrastructure throughout North America. Pearce provides technical maintenance, repair, operations, and engineering services for uninterruptible power supply (UPS) systems, backup power generators, battery energy storage systems (BESS), critical cooling systems, and other electrical and mechanical infrastructure across end markets such as renewable energy, telecom, and data centers. Founded in 1998, Pearce has more than 4,000 employees and 28 locations across the U.S. Pearce is a wholly owned subsidiary of CBRE Group, Inc., the world's largest commercial real estate services and investment firm. To learn more about Pearce visit http://wwContact Government Services, LLC
Atlanta, GA • (41.1 miles) • Full Time • 9/2/2026
Jira Lead Admin Employment Type: Full-Time, Mid Level Department: Information Technology CGS is seeking a talented Jira Lead Administrator who is passionate about driving transformation in the federal IT domain to join our growing team of technology and software consulting professionals. Strong candidates will have a desire to drive change in the federal space by developing executable strategies, implementing new technologies, streamlining processes, and improving the delivery of mission value delivery through new practices and tools. CGS brings motivated, highly skilled, and creative people together to solve the government’s most dynamic problems with cutting-edge technology. To carry out our mission, we are seeking candidates who are excited to contribute to government innovation, appreGet Fast Shirt Apparel
Flowery Branch, GA • (0.6 miles) • Full Time • 9/27/2026
About Getfastshirt.comGetfastshirt.com is a fast-growing leader in the custom apparel and commercial printing industry, proudly delivering high-quality, versatile solutions for businesses, teams, events, and individuals. With a commitment to speed, precision, and customer satisfaction, we specialize in a full range of printing services including embroidery, direct-to-film (DTF) printing, screen printing. But we don’t stop at fabric. Our capabilities stretch across engraving, stickers, signage, and a wide array of commercial print solutions designed to elevate your image and message with precision and flair.Whether looking to outfit team with branded uniforms, create eye-catching promotional items, or bring unique design to life on apparel or signage, Getfastshirt.com combines advanced techAutomation Personnel Services
Dacula, GA • (13.6 miles) • Full Time • 9/27/2026
ASOCIADO DE LOGSTICA Y ALMACN Automation Personnel Services est buscando un Asociado de Logstica y Almacn para una empresa ubicada en Dacula, GA. En este puesto, tendr la oportunidad de desarrollar sus habilidades en logstica, control de inventario y manejo de materiales mientras forma parte de una compaa lder a nivel mundial en soluciones para la industria de la construccin. Salario $18.50 por hora Horario y Turno Lunes a Viernes, 12:00 PM – 8:30 PM,con horas extras segn sea necesario. Almuerzo: 4:00 PM – 4:30 PM Responsabilidades y Deberes delAsociado de Logstica y AlmacnRecibir, inspeccionar y procesar materiales devueltos por los clientes.Identificar y evaluar las condiciones de equipos y componentes devueltos.Tomar fotografas y documentar las devoluciones segn los procedimientos estabEskewDumezRipple
Atlanta, GA 30319 • (32 miles) • Full Time • 9/27/2026
About EskewDumezRippleEskewDumezRipple (EDR) is a nationally recognized group of architects, designers, and thinkers operating within the fields of architecture, interior design, research, and urban strategies with studios in New Orleans and Washington DC.Our studio itself is a diverse group of people from all over the world, a resonant gathering of experiences and expertise. We are curious and determined. We nurture a culture that encourages a spirit of collaboration and attracts inquisitive people.Our work unfolds at every scale, harmoniously integrating interiors and buildings with neighborhoods and communities.About the JobWe are currently seeking a Project Architect with 8+ years of experience to join our studio in New Orleans, LA. This role will contribute to a variety of projects acECI Management LLC
Atlanta, GA 30339 • (38.4 miles) • Full Time • 9/27/2026
Description: ECI Group is currently hiring a Director, IT Operations & Strategy to serve as the head of our technology department, with full ownership of both the strategic direction and day-to-day operations of technology across the organization. This is not a pure strategy role, nor is it a pure operations role. You will set the technology vision and own day-one execution. You will be equally comfortable presenting a three-year technology roadmap to the executive team and rolling up your sleeves to resolve a critical system issue. We are looking for a proven leader who understands that at a dynamic, growth-oriented company, great strategy and great operations are inseparable. If you are energized by building something meaningful, leading a team, and leaving the technology environment meaONEPOWER Consulting
Smyrna, GA • (41.1 miles) • Full Time • 9/27/2026
JOB TITLE: Service EngineerREPORT TO: Service ManagerFLSA STATUS: Non-ExemptRESPONSIBILITIES:Responsibilities to include the following. Other duties may be assigned from time to time at the Company’s sole discretion.Utilize professional knowledge and experience to maintain the Company's safety standards in accordance with OSHA and state regulations when working on equipment. while working with vitality and disciplineProvide on-site installation, validation and commissioning of machinery/mold as well as diagnosing and repairing existing machinery/mold in the field, in accordance with the Company standards and in line with professional judgment. Pursue customer satisfactionExercise independent discretion to develop and maintain good customer relations in the performance of duties, while mainATN HR Consulting
Alpharetta, GA 30005 • (19 miles) • Full Time • 9/27/2026
Location: Alpharetta, GA (Hybrid)Employment Type: Full-Time, ExemptDepartment: MarketingReports To:Senior Growth Marketing ManagerPosition Summary Swain Apparel Group is seeking a creative, detail-oriented Marketing Graphic Designer to join our growing marketing team. This role is responsible for developing original visual content that supports marketing campaigns, brand initiatives, and business development efforts across digital and print platforms.A significant portion of this role will focus on designing original email marketing creative in collaboration with our Email Marketing Strategist. The ideal candidate is experienced in creating custom marketing assets from concept to completion-not simply modifying templates-and has a strong understanding of visual storytelling, branding, andCommunications Engineering Company
Atlanta, GA 30361 • (38 miles) • Full Time • 9/27/2026
OBJECTIVE:Executing high level project management support to CEC's top customer accounts. Providing high level communication both internally and externally to meet customer expectations while having CEC's best interests in mind; proactively driving projects to be completed on time, within budget and by specifications.CORE RESPONSIBILITIES include, but are not limited to the following:· Project Notification:o Ensures customer is contacted within 48 hours of project Award.o Reviews overall project objectives and timelines with customer and establishes ongoing communication strategy.o Ensures all required project information has been provided to Operations from Sales and Engineering.o Assigns project related tasks within ConnectWise in relation to project timelines.· Project Information RevieSMA America
Atlanta, GA • (41.1 miles) • Full Time • 9/27/2026
Why Work at SMA AmericaPower the future. Build your career at SMA America.As the U.S. subsidiary of SMA Solar Technology AG, we have been at the forefront of solar inverter technology since 1981, developing solutions that make photovoltaic power plants simpler, more reliable, safer, and more cost effective. Headquartered in Rocklin, California, SMA America has spent more than two decades helping homes, businesses, and utilities across the country generate clean, reliable power. We are the only inverter manufacturer in the world offering solutions for every system size, from residential rooftops to large scale utility plants, backed by more than 1,500 patents and a presence in over 190 countries.Innovation is only part of the story. We invest in our people, create room to grow, challenge coMaxIT Consulting - Max Corporate Group
Atlanta, GA • (41.1 miles) • Full Time • 9/27/2026
S/4HANA Transformation & Integration Lead Atlanta, Georgia, USA | Full-time | On-siteMaxIT Consulting – Max Corporate Group is looking for a highly experienced S/4HANA Transformation & Integration Lead to support a large-scale enterprise transformation and global SAP rollout program within a major organization in the manufacturing sector.This is a senior techno-functional architecture role requiring broad ownership across SAP S/4HANA, Salesforce, integrations, data, security, enterprise applications, and business processes. The selected professional will work closely with business and technology leadership to define and govern the end-to-end target architecture.About the Role You will lead enterprise and solution architecture across a complex SAP transformation landscape, ensuring alignmenCoinme
Atlanta, GA • (41.1 miles) • Full Time • 9/27/2026
At Coinme, we're redefining access to financial services in a digital world. By combining the cutting-edge power of blockchain technology with everyday simplicity, we make digital currencies accessible and usable for all.As the world's largest network of cryptocurrency kiosks with over 40,000 locations nationwide, we're breaking down barriers to crypto adoption through our seamless mobile app, secure digital wallet, and DeFi integrations. Beyond our consumer offerings, we're also the infrastructure powering the crypto revolution for businesses.Through our enterprise Crypto-as-a-Service (CaaS) platform, we enable businesses to launch crypto capabilities in weeks, not months. Our modular, API-first infrastructure provides everything from KYC and payment processing to liquidity and custody soEOS
Atlanta, GA • (41.1 miles) • Full Time • 9/27/2026
OUR COMPANY:EOS IT Solutions is a Global Technology and Logistics company, providing Collaboration and Business IT Support services to some of the world's largest industry leaders, delivering forward-thinking solutions based on multi-domain architecture. Customer satisfaction and commitment to superior quality of service are our top business priorities, along with investing in and supporting our partners and employees.We are a true International IT provider and are proud to deliver our services through global simplicity with trusted transparency.WHAT YOU WILL DO:As a Fiber Optical Splicing Technician, you will be responsible for the installation, splicing, testing, troubleshooting, and maintenance of fiber optic cabling infrastructure. This hybrid role combines the practical skills of an IHilton Mechanical Contractors
Alpharetta, GA • (22.2 miles) • Full Time • 9/26/2026
About the Role Hilton Mechanical Contractors hires across a wide range of trades, support, and administrative roles that we don't always have posted at any given time. If you have experience that fits our work and you'd like to be considered, submit your application here and tell us what you do.Every application submitted through this posting is reviewed by our HR and hiring team and routed to the appropriate manager.Roles filled through this application may include, but are not limited to:Field & Trades mechanical piping, HVAC, plumbing, plastic fusion, ironwork, rigging, general laborFabrication & Shop fab shop production, material handling, shop supportPreconstruction & Project Support estimating, project coordination, project management support, purchasingFleet, Facilities & WarehouseCobb Convention Center-Atlanta
Atlanta, GA 30339 • (38.4 miles) • Full Time • 9/26/2026
Description: The Facility Service Engineer 1 is responsible for the operation and maintenance of electrical services as prescribed and will perform within the Engineering Department guidelines, to include but not limited to: performing preventive maintenance of electrical installations, preventive maintenance of HVAC systems, Preventive Maintenance of Plumbing Systems, exhibitor utility services installation for water, power, etc., utility services supply inventory checks, exhibit hall maintenance, monitoring operation techniques as to safety procedures, complying with equipment distribution requests, review required operation techniques, completing daily routine and/or event assignments as required, and such other functions and duties as required. Requirements: Experience· 2 years’ experiHydro North America
Gainesville, GA 30501 • (11 miles) • Full Time • 9/26/2026
Hydro Extrusions is a world-leading aluminium extrusion business counting around 100 production sites in 40 countries and employing 20,000 people. Through our unique combination of local expertise, global network, and unmatched R&D capabilities, we can offer everything from standards profiles to advanced development and manufacturing for most industries.Since 1905, Hydro has turned natural resources into valuable products for people and businesses with focus on a safe and good workplace for our 30,000 employees in more than 140 locations.What we offer youMedical, Rx, Dental, Disability, Life Insurance, Flexible Spending AccountsRetirement Savings Plans with Company Match/ContributionsEducation AssistanceBonus Plan EligibilityParental LeaveWhat you will be doingJob Summary: The ReliabilityConstruction Execs
Suwanee, GA 30024 • (13.1 miles) • Full Time • 9/26/2026
Industrial Design-Build and General ContractingWe are seeking an experienced Preconstruction Manager responsible for supporting the BD team. The focus will be on budget development, while bridging the communications between the clients and the Project Executive Team. The role will oversee the budget development process, coordinates with design partners, sub-contractors, and operations staff to create an environment for successful project acquisition and delivery. The Role’s Duties & Responsibilities1.BUSINESS DEVELOPMENT SUPPORT·Manage budget & proposal development in coordination with Business development and in-house estimating/engineering staffs to create effective customer relationships.·Establish and maintain relationships with architects, clients, sub-contractors, local jurisdiction,THE UPS STORE
Lawrenceville, GA • (16.3 miles) • Full Time • 9/26/2026
The Graphic Designer is responsible for following through on all customer graphics orders and will help with volume copying. In addition to effective conceptualization abilities, strong design skills, and technical expertise, the Graphic Designer must be highly collaborative by nature and must have demonstrated strengths in graphics design, project management, and communication. The ideal candidate has a Bachelor’s degree in visual communication, graphic design, or a related field; at least two years of experience in graphic design or in the print industry, and is skilled in copy-editing/proof-reading and desktop publishing. He or she must have full mastery of various software design programs including Adobe-based platforms (Acrobat, InDesign, Illustrator, and Photoshop) for both Mac and PSygna Solutions
Alpharetta, GA 30022 • (21.9 miles) • Full Time • 9/26/2026
Location: Alpharetta, GA – OnsiteEmployment Type: Full-Time / ContractExperience: 10+ Years in SAP FICOBusiness-Facing Experience: Strong client-facing/business explanation experience; ideally less than 5 years in a dedicated business-facing/functional advisory capacity.Role Overview:We are looking for a highly experienced SAP FICO Business Consultant with 10+ years of hands-on SAP FICO experience who can work directly with business stakeholders and clients.The ideal candidate should have strong SAP FICO knowledge and, most importantly, the ability to understand complex technical/functional topics and explain them clearly to clients, business users, and leadership. The consultant must be confident in client meetings, requirement discussions, solution walkthroughs, and presentations.Ideal CDATASEERS INC
Alpharetta, GA • (22.2 miles) • Full Time • 9/26/2026
Role Summary DataSeers is looking for experienced ETL Developers / Data Engineers with HPCC Systems and ECL experience to build and maintain large-scale financial data pipelines.A significant portion of DataSeers' data ingestion, normalization, transformation, linking, enrichment, and analytical processing is performed using HPCC Systems and Enterprise Control Language (ECL).This is not a traditional SQL-only ETL position. You will work with large and complex financial datasets and develop ECL-based data workflows that transform disparate source data into standardized, reliable datasets used across DataSeers products.You will work with data from banks, credit unions, fintechs, payment processors, core banking systems, and other financial platforms.What You Will Do Develop, maintain, and opSystem One
Alpharetta, GA • (22.2 miles) • Full Time • 9/26/2026
For immediate consideration, please connect with me on LinkedIn at https://www.linkedin.com/in/dpotapenko and then email your resume, current location, availability, and compensation expectations directly to - make sure to include the exact job title and job location in your email message.We are seeking a Microsoft Systems Administrator ( Microsoft 365 Security Administrator ) to support, maintain, and secure Microsoft 365 environments. This role will administer Microsoft O365 and email security services, manage user and device access, endpoint management, and maintain security controls across the organization. The ideal candidate will have strong experience with Microsoft 365 administration, Microsoft security technologies, identity and endpoint management.Responsibilities : - Con?gure anBeckhoff Automation Llc
Alpharetta, GA 30009 • (23.6 miles) • Full Time • 9/26/2026
Beckhoff Automation is seeking a technically motivated, customer-centric Automotive Industry Application Engineer to help shape the future of automation in the North American. In this high-impact role, you will serve as a trusted technical partner to our automotive customers, enabling their success with cutting-edge automation, control, and end-of-line test solutions.Working closely with our Automotive Industry Manager and global stakeholders, you’ll play a key role in executing our go-to-market strategy, driving the adoption of Beckhoff technologies, and contributing to growth across leading OEMs and Tier suppliers. This position blends deep technical engagement with strategic industry focus in one of Beckhoff’s most dynamic verticals.The ideal candidate thrives at the intersection of engAVASO Technology Solutions Inc
Norcross, GA 30093 • (24.2 miles) • Full Time • 9/26/2026
JobDescriptionSummary:TheITFieldTicketCoordinator’sresponsibilitiesaretoreceive,validate,schedulewithcustomer,plan,andassignticketstodesignatedfieldtechniciansforpartspick-upsandhardwareITrepairservices.TheITfieldticketcoordinatorwillcommunicatedirectlywiththedesignatedfieldtechniciansresponsibleforservicesaswellaswiththeend-customersrequestingservice.TheITFieldTicketCoordinatorwillberequiredtoadheretocontractualServiceLevelAgreements(“SLAs”).KeyResponsibilities:Receive, validate, update, and end-user requests for hardware repair services via ticketing system and in compliance with contractual SLAs.Schedulerepairserviceswithend-usersviaphoneand/ore-mail.Planandassigndesignatedfieldtechnicianstoend-userserviceticketsasefficientlyaspossible.Providecustomerservicesupportviaphoneand/ore-mail.CGeorgia System Operations Corporation
Tucker, GA 30084 • (28.5 miles) • Full Time • 9/26/2026
Senior Energy Systems Analyst III - IVDesign, Support, and Improve Critical Energy Billing and Settlement SystemsGeorgia System Operations Corporation (GSOC) is seeking a Senior Energy Systems Analyst to provide functional and technical ownership of the applications, data processes, controls, and business rules that support accurate and timely Member billing, energy settlements, contract calculations, and related reporting across the Family of Companies.This role combines business systems analysis, application development, data analytics, and technical leadership to ensure critical energy billing and settlement solutions remain accurate, reliable, scalable, and audit-ready.The Senior Energy Systems Analyst designs, develops, supports, and improves solutions using Excel/VBA, SQL, MicrosoftEuna Solutions
Atlanta, GA 30338 • (28.5 miles) • Full Time • 9/26/2026
The Opportunity:We are seeking a Team Lead, Technical Solutions, who'll lead a team of 4 Technical Solutions Specialists through requirements gathering, configuration, and implementation of payment solutions for our customers. You will collaborate closely with cross-functional teams including sales, product management, engineering, customer success, and technical support - to deliver exceptional client experiences and drive customer satisfaction. This role combines deep technical expertise, sophisticated consultant skills, and leadership to deliver high-quality solutions while partnering with product teams on innovative feature development. You'll be the expert our customers and team turn to for guidance on payment integrations, API architecture, and complex technical challenges.Key ResponAscend Aesthetic Partners
Atlanta, GA 30346 • (30.2 miles) • Full Time • 9/26/2026
About UsAscend Aesthetic Partnersis a premier management services organization (MSO) dedicated to supporting exceptional plastic surgery and aesthetic practices for multiple states. We partner with leading surgeons and healthcare professionals to provide the operational expertise, strategic resources, and innovative solutions they need to deliver outstanding patient care while growing thriving, sustainable practices.Our comprehensive support includes human resources, finance, marketing, compliance, revenue cycle management, information technology, business development, and operational leadership. By handling the complexities of practice management, we empower our physician partners and clinical teams to focus on what matters mostdelivering exceptional patient experiences and achieving lifeMunicipal Electric Authority Of GA
Atlanta, GA 30328 • (32.2 miles) • Full Time • 9/26/2026
Position Title: Senior Systems AnalystDepartment: Information ServicesReports to: Manager, Application Development and SupportLocation: Atlanta, GA (*On-Site)* During the first three (3) months of employment the incumbent will be required to work five (5) days a week onsite in the office, however thereafter they will be given the opportunity to work remotely one (1) day per week with manager approval.Summary:This position participates as a member of the team to deliver reliable, efficient and high performing technology-based solutions; assists in the design, development, testing, support, and maintenance of multiple business applications (both packaged and custom); works in a constructive and determined manner to execute the strategies and goals determined by management.Key ResponsibilitieSafe-Guard Products International LLC
Atlanta, GA 30328 • (32.2 miles) • Full Time • 9/26/2026
Please do not respond to direct messages with your personal information. All job applications and your sensitive, personal information should only be submitted via our official job platform.External Job Title: Full Stack Manager- Java and Angular(hybrid onsite Monday- Thursday)Internal Job Title:Manager, Software EngineeringLocation: US-GA-Atlanta (Sandy Springs)FLSA: Exempt#LI-HybridJob Overview:We are seeking a Manager of Software Engineering to lead a full-stack engineering team of 10+ engineers across onshore and offshore locations, owning our Contract Cancellations and Claims Payments platforms, including both internal and external-facing applications. This role reports to the Sr. Engineering Manager over Claims and Cancellations and is responsible for the delivery, stability, and modThe FDA Group
Atlanta, GA 30301 • (35.7 miles) • Full Time • 9/26/2026
Medical Device Quality Systems & FDA Inspection Readiness ConsultantLocation: Atlanta/Duluth, Georgia areaWork Arrangement: OnsiteDuration: Immediate start through November 2026, with potential extensionStart: ImmediatePosition OverviewWe are seeking an experienced Medical Device Quality Systems Consultant to provide hands-on support for the startup of a new Class I medical device contract manufacturing operation.The consultant will support Quality Management System (QMS) implementation, development of auditable quality and operational processes, system validation, and FDA inspection readiness. A key focus will be ensuring appropriate controls are established across production, warehousing, inventory, traceability, product hold/quarantine, release, and direct-to-consumer distribution activSageNet LLC
Marietta, GA 30067 • (35.9 miles) • Full Time • 9/26/2026
WHO WE ARE Empowering Connections, Inspiring PossibilitySageNet is a leading managed services provider specializing in connectivity, digital signage and cybersecurity. The company connects, manages and protects technologies and devices across widely distributed enterprises. SageNet’s people, processes and technologies, coupled with its collaborative approach, empowers customers to achieve their core business objectives.The company offers world-class service and support via its US-based 24/7/365 Network Operations Centers and Security Operations Centers, geographically diverse teleports, a central National Logistics Center, multiple data centers, and a nationwide field service organization.What makes SageNet unique is its Why. SageNet is passionate about Trusted Connections. This is a two-fHueman PE Talent Solutions
Atlanta, GA 30339 • (38.4 miles) • Full Time • 9/26/2026
Strategic Implementation Manager opportunity with Connexure in Atlanta, Georgia. Connexure is a software company fully dedicated to serving the self-funded medical benefits ecosystem. Our software helps stop-loss carriers, brokers, and third-party administrators quote, underwrite, and administer stop-loss policies. Our mission is to unify the self-funded medical ecosystem through integrated technologies, artificial intelligence, processes, and data insights. Our leadership team believes in a customer-centric approach to driving value and creating a network effect where the software becomes value-additive through stakeholder interoperability. We are looking for talented and motivated individuals who align with our vision and will support the next phase of growth.The Implementation Manager oSOUTHEASTERN CYBER LLC
Atlanta, GA 30332 • (39.7 miles) • Full Time • 9/26/2026
Benefits:Flexible scheduleTraining & developmentRole Summary Southeastern Cyber LLC is seeking a Digital Design / Toolchain Engineer to extend our proprietary toolchains and pipelines. The engineer will integrate various policies into an automated flow for system and hardware design. Responsibilities - Develop and extend EDA/RTL compilation tools and scripts (Python, C++, and/or Rust). - Map quantified requirements into physical standard-cell routing and logic structures. - Run synthesis, place-and-route, and area/power/timing (PPA) estimates to sweep architectural scaling limits (max model parameter count, max whitelist/blacklist size). - Interface with the Principal Investigator and Hardware SME to ensure correct RTL generation and physical implementation. Required Qualifications - B.S.Legacy Mechanical Services Parent LLC
Kennesaw, GA 30144 • (40.3 miles) • Full Time • 9/26/2026
Legacy Mechanical, a Crete United Company is looking to hire a Senior Controls Technician/Project Manager in the Kennesaw, GA area. The Senior Controls Technician/Project Manager is responsible for field installation, system programming, and commissioning, while also being self-sufficient in managing and successfully completing projects throughout the full project lifecycle (estimating, selling, and managing Mechanical/Construction Projects). This role is intended to support both our current workload and our continued growth in the controls segment of the business. This position requires a self-motivated individual who is dependable and process oriented. The employee should have a high level of attention to detail, be accurate and consistent, and work well with others.Qualifications, functMullins Mechanical
Atlanta, GA • (41.1 miles) • Full Time • 9/26/2026
About YouAre you a client focused construction leader who actively works to ensure project profitability? Do you have a 'can do' attitude and an unwavering commitment to excellence? If this sounds like you, then you should mull over a career with Mullins Mechanical.We're looking for an experienced Project Executive to join our team. As a Project Executive at Mullins, you will be a key player in managing and guiding construction projects from inception to completion. Your responsibilities will include leading mega projects while mentoring and advising Senior Project Managers, Project Managers, and Assistant Project Managers, overseeing high-profile and complex projects, and developing strong client relationships. Your role will encompass various aspects from project setup to closeout, and yMoore Colson
Atlanta, GA • (41.1 miles) • Full Time • 9/26/2026
Company Overview: Moore Colson is a leading CPA and consulting firm in Atlanta with over 40 years of experience. Known for its collaborative, client-focused approach, Moore Colson offers a wide range of services to help businesses grow and achieve their goals. Moore Colson has an exciting internship opportunity for dynamic, motivated, and self-driven students to join ourAssurance teamin Atlanta fromJanuary - April 2028. This is an excellent chance to gain hands-on experience in auditing and public accounting, preparing you for a successful career in the field. The successful candidates will work closely with our experienced audit professionals and get exposure to various aspects of audit practice. Key Responsibilities: Preparing financial statements and related disclosures in accordance wiCapTech Consulting
Atlanta, GA • (41.1 miles) • Full Time • 9/26/2026
Company Description CapTech is a technology consulting firm dedicated to helping clients achieve their business objectives through innovative technology solutions. With a commitment to excellence and collaboration, CapTech partners with leading companies to deliver digital transformation, software development, and technology consulting services.Job Description Consulting at CapTechPartner with clients on crossfunctional, teambased projects to deliver scalable Salesforce solutions across the full Software Development Lifecycle (SDLC) using Agile methodologiesServe as a trusted technical advisor, managing architectural scope while aligning technical solutions with business goalsCommunicate effectively with both technical and nontechnical stakeholders, setting clear expectations and guiding dCato Networks
Atlanta, GA • (41.1 miles) • Full Time • 9/26/2026
Welcome to the future of cloud networking and security!Cato Networks is the first company to converge enterprise networking and security into one centralized and global service that is delivered by cloud. It is led by networking and security pioneer Shlomo Kramer (Check Point, Imperva) and early investor (Palo Alto Networks, Exabeam, Trusteer and more). Cato's unique technology inspired a brand-new product category, later named "SASE" by Gartner and a market expected to reach $28.5 billion by 2028. This is your opportunity to get on the rocket ship and join a company that is building a cutting-edge enterprise network and secure cloud platform, and is on a fast track to becoming the worldwide market leader – don't miss it!As Technical Enablement Team Lead, you will lead the strategy, executClarkston Consulting
Atlanta, GA • (41.1 miles) • Full Time • 9/26/2026
This job is posted in multiple locations. When not at a client site, consultants work from their home office. Relocation is not required.Clarkston Consulting is seeking motivated, self-driven leaders who are energized by team results and interested in joining a firm that values its culture and people as its biggest strengths. Come join us as an SAP PP Senior Consultant, and in this role, you will deliver creative business solutions to our market-leading clients in the life sciences, consumer products, and retail industries.Together, we can find the answers to our clients' most challenging business problems through a combination of our industry expertise, business process knowledge, and consulting excellence.What You’ll DoAs an SAP PP Senior Consultant at Clarkston you will:Lead and guide cOneTrust
Atlanta, GA • (41.1 miles) • Full Time • 9/26/2026
Strength in Trust OneTrust's mission is to enable innovation through the responsible use of data and AI. We believe that ensuring data is trusted shouldn't slow teams downit should accelerate what's possible. This led us to develop the first technology platform for responsible data use in 2016. Today, with AI representing the latest and most impactful expansion of data yet, OneTrust is once again redefining what responsible innovation looks like. OneTrust, the AIReady Governance Platform, unifies regulatory intelligence, automation, and connected governance workflows so businesses can continue to move at the speed of AI while ensuring good governance to prevent data misuse at scale. Trusted by thousands of organizations worldwide, OneTrust is shaping the future where trusted data becomes