Atlanta, GA • (28.5 miles) • Full Time • 9/27/2026

OUR COMPANY:EOS IT Solutions is a Global Technology and Logistics company, providing Collaboration and Business IT Support services to some of the world's largest industry leaders, delivering forward-thinking solutions based on multi-domain architecture. Customer satisfaction and commitment to superior quality of service are our top business priorities, along with investing in and supporting our partners and employees.We are a true International IT provider and are proud to deliver our services through global simplicity with trusted transparency.WHAT YOU WILL DO:As a Fiber Optical Splicing Technician, you will be responsible for the installation, splicing, testing, troubleshooting, and maintenance of fiber optic cabling infrastructure. This hybrid role combines the practical skills of an I

Atlanta, GA • (28.5 miles) • Full Time • 9/27/2026

At Coinme, we're redefining access to financial services in a digital world. By combining the cutting-edge power of blockchain technology with everyday simplicity, we make digital currencies accessible and usable for all.As the world's largest network of cryptocurrency kiosks with over 40,000 locations nationwide, we're breaking down barriers to crypto adoption through our seamless mobile app, secure digital wallet, and DeFi integrations. Beyond our consumer offerings, we're also the infrastructure powering the crypto revolution for businesses.Through our enterprise Crypto-as-a-Service (CaaS) platform, we enable businesses to launch crypto capabilities in weeks, not months. Our modular, API-first infrastructure provides everything from KYC and payment processing to liquidity and custody so

Atlanta, GA 30339 • (27.6 miles) • Full Time • 9/26/2026

Description: The Facility Service Engineer 1 is responsible for the operation and maintenance of electrical services as prescribed and will perform within the Engineering Department guidelines, to include but not limited to: performing preventive maintenance of electrical installations, preventive maintenance of HVAC systems, Preventive Maintenance of Plumbing Systems, exhibitor utility services installation for water, power, etc., utility services supply inventory checks, exhibit hall maintenance, monitoring operation techniques as to safety procedures, complying with equipment distribution requests, review required operation techniques, completing daily routine and/or event assignments as required, and such other functions and duties as required. Requirements: Experience· 2 years’ experi

Kennesaw, GA • (26.7 miles) • Full Time • 9/26/2026

Key ResponsibilitiesCreate / produce information models related to project definition or updates during the construction phase.Update information models to reflect changes occurring in the asset during the operational phase.Develop information models according to the BIM uses requested by the appointing party.Prepare BIM models for coordination with other stakeholders, following the guidelines of the project’s BIM coordinatorsand client requirements.Resolve assigned clashes and coordination issues.Report coordination issues for further review. (RFI)Prepare documentation required to meet deliverables related to both development and operational phase processes.(Panel Book & Panel Layout)Develop and maintain both graphical and non-graphical models in accordance with the project standards.Prep

Atlanta, GA 30337 • (27.6 miles) • Full Time • 9/26/2026

You are invited to apply for Metro Supply Chain Holdings...Now accepting Open Applications.

Atlanta, GA • (28.5 miles) • Full Time • 9/26/2026

Company Overview: Moore Colson is a leading CPA and consulting firm in Atlanta with over 40 years of experience. Known for its collaborative, client-focused approach, Moore Colson offers a wide range of services to help businesses grow and achieve their goals. Moore Colson has an exciting internship opportunity for dynamic, motivated, and self-driven students to join ourAssurance teamin Atlanta fromJanuary - April 2028. This is an excellent chance to gain hands-on experience in auditing and public accounting, preparing you for a successful career in the field. The successful candidates will work closely with our experienced audit professionals and get exposure to various aspects of audit practice. Key Responsibilities: Preparing financial statements and related disclosures in accordance wi

Atlanta, GA 30332 • (29.6 miles) • Full Time • 9/26/2026

Benefits:Flexible scheduleTraining & developmentRole Summary Southeastern Cyber LLC is seeking a Digital Design / Toolchain Engineer to extend our proprietary toolchains and pipelines. The engineer will integrate various policies into an automated flow for system and hardware design. Responsibilities - Develop and extend EDA/RTL compilation tools and scripts (Python, C++, and/or Rust). - Map quantified requirements into physical standard-cell routing and logic structures. - Run synthesis, place-and-route, and area/power/timing (PPA) estimates to sweep architectural scaling limits (max model parameter count, max whitelist/blacklist size). - Interface with the Principal Investigator and Hardware SME to ensure correct RTL generation and physical implementation. Required Qualifications - B.S.

Atlanta, GA 30305 • (31.2 miles) • Full Time • 9/26/2026

Assistant Project Manager – Commercial Construction | Atlanta, GeorgiaReady to take the next step in your construction management career? We're looking for an Assistant Project Manager to support commercial construction projects and learn alongside experienced industry professionals.About the CompanyOrdner Construction has spent nearly four decades building lasting relationships through quality commercial construction services. The company offers exposure to a wide variety of project types while providing opportunities for professional growth and advancement.What You'll DoManage RFIs, submittals, and project documentationAssist with scheduling, procurement, and cost trackingCoordinate subcontractors and vendorsSupport project managers throughout the project lifecycleHelp ensure successful

Atlanta, GA 30328 • (33.5 miles) • Full Time • 9/26/2026

Position Title: Senior Systems AnalystDepartment: Information ServicesReports to: Manager, Application Development and SupportLocation: Atlanta, GA (*On-Site)* During the first three (3) months of employment the incumbent will be required to work five (5) days a week onsite in the office, however thereafter they will be given the opportunity to work remotely one (1) day per week with manager approval.Summary:This position participates as a member of the team to deliver reliable, efficient and high performing technology-based solutions; assists in the design, development, testing, support, and maintenance of multiple business applications (both packaged and custom); works in a constructive and determined manner to execute the strategies and goals determined by management.Key Responsibilitie

Atlanta, GA 30346 • (35.8 miles) • Full Time • 9/26/2026

About UsAscend Aesthetic Partnersis a premier management services organization (MSO) dedicated to supporting exceptional plastic surgery and aesthetic practices for multiple states. We partner with leading surgeons and healthcare professionals to provide the operational expertise, strategic resources, and innovative solutions they need to deliver outstanding patient care while growing thriving, sustainable practices.Our comprehensive support includes human resources, finance, marketing, compliance, revenue cycle management, information technology, business development, and operational leadership. By handling the complexities of practice management, we empower our physician partners and clinical teams to focus on what matters mostdelivering exceptional patient experiences and achieving life

Alpharetta, GA 30009 • (42.6 miles) • Full Time • 9/26/2026

Beckhoff Automation is seeking a technically motivated, customer-centric Automotive Industry Application Engineer to help shape the future of automation in the North American. In this high-impact role, you will serve as a trusted technical partner to our automotive customers, enabling their success with cutting-edge automation, control, and end-of-line test solutions.Working closely with our Automotive Industry Manager and global stakeholders, you’ll play a key role in executing our go-to-market strategy, driving the adoption of Beckhoff technologies, and contributing to growth across leading OEMs and Tier suppliers. This position blends deep technical engagement with strategic industry focus in one of Beckhoff’s most dynamic verticals.The ideal candidate thrives at the intersection of eng

Alpharetta, GA 30022 • (43.6 miles) • Full Time • 9/26/2026

Location: Alpharetta, GA – OnsiteEmployment Type: Full-Time / ContractExperience: 10+ Years in SAP FICOBusiness-Facing Experience: Strong client-facing/business explanation experience; ideally less than 5 years in a dedicated business-facing/functional advisory capacity.Role Overview:We are looking for a highly experienced SAP FICO Business Consultant with 10+ years of hands-on SAP FICO experience who can work directly with business stakeholders and clients.The ideal candidate should have strong SAP FICO knowledge and, most importantly, the ability to understand complex technical/functional topics and explain them clearly to clients, business users, and leadership. The consultant must be confident in client meetings, requirement discussions, solution walkthroughs, and presentations.Ideal C

Norcross, GA 30093 • (44.2 miles) • Full Time • 9/26/2026

JobDescriptionSummary:TheITFieldTicketCoordinator’sresponsibilitiesaretoreceive,validate,schedulewithcustomer,plan,andassignticketstodesignatedfieldtechniciansforpartspick-upsandhardwareITrepairservices.TheITfieldticketcoordinatorwillcommunicatedirectlywiththedesignatedfieldtechniciansresponsibleforservicesaswellaswiththeend-customersrequestingservice.TheITFieldTicketCoordinatorwillberequiredtoadheretocontractualServiceLevelAgreements(“SLAs”).KeyResponsibilities:Receive, validate, update, and end-user requests for hardware repair services via ticketing system and in compliance with contractual SLAs.Schedulerepairserviceswithend-usersviaphoneand/ore-mail.Planandassigndesignatedfieldtechnicianstoend-userserviceticketsasefficientlyaspossible.Providecustomerservicesupportviaphoneand/ore-mail.C

College Park, GA • (26.8 miles) • Full Time • 9/26/2026

Title: Quality Assurance AnalystCompensation: $60-72kLocation: College Park, GeorgiaBenefits: Medical, Dental, Vision, FSA/HSAAbout the Company:Nitro is a Brazilian multinational that marked 90 years in business in 2025, tracing its roots back to its founding in 1935. The company is recognized as a pioneer in Brazil's modern chemical industry and is one of the country's largest suppliers of nitrocellulose. Nitro serves clients in more than 70 countries and operates in Brazil, Uruguay, the United States, and Europe. Since 2019, the company has expanded into agribusiness specialty products through the acquisition of several units, broadening its portfolio to serve all of Brazil. In recent years, Nitro has seen strong growth, with revenue increasing more than 30% annually and sales growth exc

Atlanta, GA 30339 • (27.6 miles) • Full Time • 9/26/2026

Senior Enterprise Architect Employment Type: Full-timeReports To: VP, Services Portfolio & GTMLocation: Hybrid – Atlanta, GA (WFH flexibility)Travel: ~25% (client meetings, workshops, assessments, industry events).Role Summary We are seeking a Senior Enterprise Architect to serve as a strategic technical advisor across the full customer lifecycle. This role takes a holistic view of a client’s overall technology environment enterprise infrastructure, public cloud, digital workspace, security, and business applications and translates business strategy, risk, and compliance drivers into currentstate assessments, targetstate architectures, and actionable transformation roadmaps aligned to ivision’s services portfolio and our ASSESS ARCHITECT TRANSFORM OPERATE delivery lifecycle.The ideal candi

Atlanta, GA • (28.5 miles) • Full Time • 9/26/2026

Build reliable data foundations that help clients turn complex data into trusted, actionable insights.We are seeking a highly motivated Data Engineering Consulting Associate to join our Data & Analytics practice. In this role, you will help clients design, build, and optimize modern data platforms that enable advanced analytics, reporting, and AI-driven decision-making.You will work alongside experienced consultants, solution architects, and client stakeholders to deliver end-to-end data engineering solutions across cloud and on-premises environments. This position offers an excellent opportunity to develop both technical expertise and consulting skills while working on large-scale digital transformation initiatives.We're anticipating future openings and are connecting now with great talen

Atlanta, GA • (28.5 miles) • Full Time • 9/26/2026

About Zipline Zipline is the world's largest and most experienced drone delivery service. We are on a mission to serve all humans equally by ensuring access to food, medicine and essential goods anytime, anywhere. We design, build, and operate the world's largest autonomous logistics system, delivering critical supplies quickly and reliably. Today, Zipline operates on four continents, makes a delivery somewhere in the world every 30 seconds, and has completed millions of deliveries to date, including blood, vaccines, medical supplies, food, and retail products.Our customers include the world's largest and most prominent healthcare systems, governments, retailers, restaurants and global businesses who rely on us to save lives, reduce emissions, increase economic opportunity, and provide de

Atlanta, GA • (28.5 miles) • Full Time • 9/26/2026

COMPANY OVERVIEWWith over 37 years of experience, Peacock Partnership, Inc. is an award-winning full-service design and consulting firm with a primary focus on the healthcare industry. We offer our clients the opportunity for a single-source of responsibility from the start to finish of their project. We incorporate a comprehensive range of services, including master planning, architecture, interiors, facility consulting, and development management.POSITION SUMMARYWe are seeking a Senior Healthcare Architect with 15+ years of professional experience to act as a technical leader, master planner, and client partner for complex healthcare infrastructure projects. In this role, you will champion the design, execution, and regulatory approval of large-scale clinical environments, hospital expan

Atlanta, GA 30338 • (37.4 miles) • Full Time • 9/26/2026

SAP Enterprise ArchitectOur client is a global technology, consulting, and business-services company has been recognized by major organizations for its workplace culture, management consulting, sustainability, ethical business practices, innovation, and talent development. Recent accolades include recognition as one of the World’s Best Employers by Forbes, one of the World’s Most Ethical Companies by Ethisphere, and one of Forbes’ World’s Best Management Consulting Firms. It has also received workplace, sustainability, and employee-development awards from organizations such as Newsweek, TIME, CDP, Frost & Sullivan, and Brandon Hall Group.Position Overview Title: SAP Enterprise Architect Location: Atlanta, GA Duration: FT, Direct-hire Role PurposeLead the enterprise architecture for a large

Hampton, GA 30228 • (41.8 miles) • Full Time • 9/26/2026

Job Summary: The Application Engineer I – Power Systems is responsible for supporting the technical development, application, design, and proposal of medium-voltage and high-voltage reactive power compensation and power quality equipment. This role works closely with Customers, Sales, Engineering, Project Management, Manufacturing, and Purchasing to review project specifications, develop compliant technical solutions, prepare proposal documents, and support projects from the quotation stage through order execution. The Application Engineer will serve as a technical advisor and product advocate for the Power System Solutions Division. The role requires the ability to identify technical risks and exceptions to customer specifications, develop equipment configurations, prepare budgets and bil

Lithia Springs, GA • (15.8 miles) • Full Time • 9/25/2026

Technical designers work in the fashion industry and take garments from concept to shelf-ready products. They bring creative designs and adapt them into tangible products. They work and develop a plan with manufacturers and ensure that the finished product meets their company’s quality standards. They discuss designs with a fashion designer to generate realistic and practical compromises and draft initial sketches for approval and review.Technical designers draft a final design in a software system including AutoCAD and coordinate with manufacturers and vendors to produce the design. When a final product is delivered, technical designers review and inspect it for quality. They measure garments and accessories to align with specifications, attend product fittings, and collaborate with vendo

Lithia Springs, GA • (15.8 miles) • Full Time • 9/25/2026

About MantisWe help organizations improve how their buildings perform by bringing together energy, facility operations, and sustainability into one connected approach. At Mantis, our teams work across the full lifecycle of a facilityfrom planning and design to field execution and long-term asset managementacross commercial and industrial portfolios, data centers, and complex mechanical systems.Our work spans four core areas: Building Controls, Energy Efficiency, Energy Advisory, and Facility Managementcovering HVAC/mechanical optimization, BMS/BAS and EPMS controls, lighting system upgrades, energy brokerage, roofing and building envelope assessments, construction management, and more.Whether you’re in sales, engineering, construction/project management, field operations, corporate, or tec

Atlanta, GA 30339 • (27.6 miles) • Full Time • 9/25/2026

WhoweareOver 600 employees strong, Asure sees Human Capital Management (HCM) through the lens of entrepreneurs and executives with an owner’s mentality. We help businesses develop their “Human Capital” to get to the next level, stay compliant, and allocate their time, money and technology toward growth. Our HCM platform empowers more than 100,000 clients to build great teams and better manage their people while staying compliant in an ever-changing HR legislative landscape. Asure’s HCM offering includes Payroll & Tax, HR, and Time & Attendance software and HR Services ranging from online compliance tools to a fully outsourced HR department.How you will contributeAs an Associate Software Engineer, you will work alongside experienced engineers to design, develop, test, and maintain software

Atlanta, GA • (28.5 miles) • Full Time • 9/25/2026

Capgemini is at the forefront of innovation, integrating AI technologies to enhance customer experience and streamline operations.We are seeking an experienced and innovative Verint AI Software Engineer to join our team supporting a premier U.S. Property & Casualty insurance carrier. This role is ideal for a technologist with deep expertise in Verint AI and a strong understanding of enterprise voice ecosystems, including CISCO, Google Cloud, and NICE. You will be instrumental in designing, developing, and optimizing AI-driven solutions that enhance customer experience, operational efficiency, and digital engagement. In this role, you will work closely with cross-functional teams to design, develop, and deploy AI-driven solutions that leverage Verint AI technology to address complex busines

Atlanta, GA • (28.5 miles) • Full Time • 9/25/2026

DescriptionThought Logic Consulting is a functionally-led, digitally enabled consultancy that exists at the intersection of business transformation and technology innovation. We partner with clients to solve their most complex business problems and we do it in a highly collaborative, local-market approach, giving clients senior-level attention and giving our consultants room to grow, lead, and build.The RoleWe are looking for an experienced Oracle EPM Solution Architect, to join our growing Enterprise Performance Management practice. In this role, you will oversee the successful delivery of complex Oracle EPM engagements, advise senior finance and technology leaders, and help expand Thought Logic's capabilities and client relationships.You will combine deep Oracle EPM and finance transform

Atlanta, GA • (28.5 miles) • Full Time • 9/25/2026

At Portage Point Partners (Portage Point), you are not a cog in a legacy machine, you are shaping strategy, influencing outcomes and being rewarded for driving impact. Backed by New Mountain Capital, Portage Point is recognized for accelerated growth and is consistently featured in rankings from Inc.5000, The Financial Times and Consulting Magazine. This recognition is a testament to our focus on excellence, intensity and pace and ability to attract blue chip talent committed to delivering best-in-class outcomes. Our cross-functional platform spans the full business lifecycle and offers middle market clients integrated solutions across Transaction Advisory Services (TAS), Valuations (VAL), Transaction Execution Services (TES), Office of the CFO (OCFO), Performance Improvement (PI), Interi

Atlanta, GA • (28.5 miles) • Full Time • 9/25/2026

Job Title: Data Strategy and Governance Consultant- Any Cloud (GCP preferred)Work Time Zone: ESTRate: $60/hour on 1099/C2CLocation: Atlanta, GA (Hybrid – 3 days on-site)We are seeking a strategic, cloud-native Data Strategy and Governance Consultant with deep expertise in Google Cloud Platform (GCP) to lead enterprise-wide data transformation initiatives. This highly visible role blends technical depth with executive engagement, helping clients define and implement modern data strategies and governance frameworks that drive business value, compliance, and maturityleveraging GCP-native tools like Dataplex, Data Catalog, BigQuery, and Vertex AI.Key Responsibilities:GCP-Based Data Strategy DeliveryLead end-to-end enterprise data strategy engagements on GCP.Define scalable, cloud-native operat

Marietta, GA 30067 • (29.6 miles) • Full Time • 9/25/2026

Description: Senior DDC Programmer / Systems IntegratorNiagara N4 | Distech ControlsReports ToGeneral ManagerLocationAtlanta, GA. Office and customer job sites.LevelSenior. 5+ years of DDC programming experience.StatusFull-time. Pay Range$90k to $120 per year, based on experienceAbout CMS Controls Atlanta CMS Controls Atlanta is a building automation and controls contractor serving commercial facilities across metro Atlanta. We install, program, and service Distech, Niagara N4, and 75F systems. We also support and integrate the systems our customers already own, including Reliable Controls, ALC, Trane, Johnson Controls, Honeywell, and Carrier. Most of our work is retrofit and service, so on any given week you may be building a new Distech job or bringing a 20-year-old system into N4. We ar

Atlanta, GA 30316 • (33.6 miles) • Full Time • 9/25/2026

As a Senior HVAC Application Engineer, you will be tasked with the development of control system engineering and standard application software selection for all assigned projects. The system design will be in accordance with the project estimates, the account representative’s special instructions, and in compliance with the project design documents (plans and specifications). The system design will consist of submittal and installation documents, including: overall control network architecture, detailed wiring termination sheets, parts lists, equipment schedules, sequences of operation, application programming checklists, and point-to-point control system checkout lists. The Senior Application Engineer will be responsible for equipment selection, proper sizing, capacity calculations, and f

Peachtree Corners, GA 30092 • (42.5 miles) • Full Time • 9/25/2026

Assistant Home Service Technician (Handyman) in Alpharetta / Duluth / John's Creek / Norcross / Peachtree Corners / Roswell / Suwanee, GeorgiaAbout UsTruBlue Northeast Atlanta is a growing premium Home Repair and Handyman Services company. Our mission is to provide peace of mind to busy adults and seniors by helping them protect, maintain, and safely enjoy their homes. We are committed to doing things the right way - with integrity, professionalism, and pride in our craftsmanship. As we grow, we are looking for team members who share our passion for serving others and building something exceptional.What You’ll DoAssist with completeremodeling projects (e.g. bathroom remodels).Assist with general home repairs and maintenance tasks with care and professionalism.Deliver reliable and respectfu

Alpharetta, GA • (43.7 miles) • Full Time • 9/25/2026

Base Salary: $77,000 - $105,000Who we are:Illumia is an industry leader in bringing the best integrated technology solutions to education, healthcare, and business campuses worldwide. Illumia was built on the collective expertise of two legacy cultures, and brings together people, technology, and insight to pioneer the art of the experience across the communities we serve. Be a part of this exciting organization and improving the lives of people doing mission-critical work.Why join our team?We strive to provide the best customer experience in the industry and have succeeded with a single, strong motivating principle: We serve our user community.Our success and growth are directly attributed to our people. Our newly named company is dedicated to fostering a culture of integrity, respect, an

Austell, GA 30168 • (19.3 miles) • Full Time • 9/25/2026

**Job Title: **CNC Lathe Programmer/Operator - 2 Axis Department: CNCFLSA Status: Non-ExemptPosition Overview:The CNC Lathe Programmer/Operator plays a critical role in the production of high-quality hydraulic and pneumatic cylinders. This position is responsible for programming, setting up, and operating CNC machines to manufacture precision components that meet exact specifications and quality standards. The individual will interpret engineering drawings, create CNC programs, and perform machine setups while ensuring efficient production processes. The role requires strong attention to detail, problem-solving skills, and the ability to work collaboratively with engineering, production, and quality teams to deliver reliable, cost-effective cylinder components.Essential Duties: (Additional

Atlanta, GA • (28.5 miles) • Full Time • 9/25/2026

Position SummaryThe Development Coordinator is responsible for managing the day-to-day implementation of the Center for Black Women's Wellness fundraising program. Working under the direction of the Director of Strategic Philanthropy and alongside the Development Coordinator-VISTA, the Development Coordinator, supports donor engagement activities, owns a portfolio of donors towards proposal submission, and ensures the successful execution of annual fundraising initiatives.This position translates fundraising strategy into action by coordinating timelines, monitoring progress toward fundraising goals, implementing donor stewardship efforts, and strengthening internal development systems.Essential ResponsibilitiesFundraisingImplement annual fundraising plans and initiatives.Own a portfolio o

Atlanta, GA • (28.5 miles) • Full Time • 9/25/2026

Description: Job OverviewThe Field QA Manager provides hands-on, field-based leadership for food safety and quality assurance across GBC Food Services’ prepared food programs. This role serves as the primary quality resource for the field organization, partnering directly with National Training Specialists, Regional Managers, and Franchisees to build food safety competency, drive program compliance, and cultivate a culture of quality excellence throughout the franchise network.Operating across multiple prepared food business programs and geographically dispersed locations, the Field QA Manager designs and delivers targeted training, conducts field assessments and audits, and supports corrective action execution at the unit level. The role bridges corporate QA standards and field-level exec

Atlanta, GA • (28.5 miles) • Full Time • 9/25/2026

Company Description TestJob Description TestQualifications Test Additional Information All your information will be kept confidential according to EEO guidelines.

Atlanta, GA 30361-3503 • (28.5 miles) • Full Time • 9/25/2026

Description: About FlexTecs FlexTecs is a technology-driven organization focused on reliability, security, and continuous improvement. We value precision, accountability, and proactive problem-solving. Our technology team supports critical business operations through secure, resilient, and well-managed infrastructure platforms.If you enjoy working in a structured environment where your contributions directly impact operational excellence, system availability, and organizational success, this is the place for you.Why Join Us? · Work on business-critical infrastructure that directly supports company operations and customer success· Participate in cloud modernization and infrastructure improvement initiatives· Join a culture that values accountability, security, and operational excellence· Wo

Atlanta, GA • (28.5 miles) • Full Time • 9/25/2026

About CeribellCeribell is a medical technology company focused on transforming the diagnosis and management of patients with serious neurological conditions. The Ceribell System is a novel, point-of-care electroencephalography ("EEG") platform specifically designed to address the unmet needs of patients in the acute care setting, and is being used in hundreds of community hospitals, large academic facilities and major IDN's across the country. Our entire team is driven by a shared commitment to transforming the landscape of critical care through our rapid seizure detection technology, come join the movement!The Manager of National Health Systems is a senior commercial role focused on building, managing, and expanding strategic partnerships with large Integrated Delivery Networks (IDNs), la

Norcross, GA 30071 • (43.3 miles) • Full Time • 9/25/2026

Applicants must be authorized to work for ANY employer in the U.S.We are unable to sponsor or take over sponsorship of an employment Visa currently.No agencies please.This hybrid role requires onsite presence at the Norcross HQ twice per week.USAN is an innovative contact center solutions provider, a respected community leader, and an all-around great place to work. We promote work-life effectiveness for all our employees by creating a supportive, flexible, and collaborative work environment. We have a high-performance culture, where we treat our employees as individuals, as professionals, as key members of the team, and like family.We are seeking highly motivated DevOps people to join a small, fast-moving DevOps team responsible for building, automating, securing, and operating cloud-nati

Atlanta, GA 30332 • (29.6 miles) • Full Time • 9/24/2026

Description: ABOUT REVELxpREVELxp is a premier sports hospitality company. We work with hundreds of college and professional teams and major sporting events to deliver exceptional fan experiences, including full-service tailgates, premium hospitality events and exclusive ticket packages. In addition to managing fan experience offerings, we also provide comprehensive hospitality solutions to our team and event partners with event staffing, event management, premium hospitality management and venue installations.We are growing at a rapid pace and are looking for goal-oriented, purpose driven, high-energy individuals to join our team!We created REVELxp to reimagine and redefine game day with memory-making experiences that ignite fan passion, drive attendance, and build loyalty for sports and

Atlanta, GA 30339 • (27.6 miles) • Full Time • 9/24/2026

Position TitleProgram Director, Surgical Technology & Surgical First Assistant Programs (Atlanta, GA)DescriptionAt Chattanooga College, team members help implement our strategy of “Where a small school can make a BIG difference!”The Program Director, Surgical Technology & Surgical First Assistant Programs provides academic leadership, program development, and instructional oversight to support student success, workforce readiness, and programmatic accreditation. This role is responsible for leading the development and implementation of Surgical Technology and Surgical First Assistant programs, ensuring alignment with CAAHEP and ARC/STSA standards, industry best practices, and institutional goals.Responsibilities include curriculum development, accreditation preparation, clinical affiliatio

Atlanta, GA • (28.5 miles) • Full Time • 9/24/2026

Company Description Forever On! From the start in 2008, T5 has been focused on supporting enterprise and hyperscale customers with customized data center solutions. Today, we remain dedicated to an unrivaled level of quality that extends across the lifecycle of the core data center ranging from customized turnkey development, facilities management and data center operations to customized construction needs worldwide! The world’s biggest companies trust T5 with their data center operations. At T5, our success is fueled by our team. With over 400 engineers, technicians and professional staff, we’re proud to foster an inclusive culture of excellence and progression that’s dedicated to serving our customers -Commitment to Diversity & Military Veterans -Battle-Tested Leadership Experience -100%