Please Accept our Privacy Policy
Datasmart/Duncan Security LLC
Houston, TX • (41.9 miles) • Full Time • 9/15/2026
Job Summary: This position is responsible for the installation and activation of monitored security systems through the Company. Is responsible for trouble shooting and repairing these systems when needed. It also helps with other low voltage/AV/network installations of products purchased by the customer.Responsibilities:Basic alarm panel programming.· Basic networking knowledge from router set up, terminating all fittings (Cat 5, Cat 6, R66, BNC, etc.) and inserts.· Speaker installs and volume controls.· Able to find cables or tone cables in walls.· Assists with television hangs.· Able to install WI-FI packages.· Activations for Alarm.com and Total Connect.· Able to install cameras and DVRs.· Knowledge of security panels.· Television hangs without help.· Able to hook up audio/amps.· ProjeFirst Response Solution LLC
Houston, TX • (41.9 miles) • Full Time • 9/15/2026
First Response Solution - Security Officer (Commissioned/Non-Commissioned)Position Type: Part and Full TimePay Rate: starting pay at $12/hour (DOE)At First Response Solution, we are committed to delivering unparalleled security services rooted in integrity, professionalism, and real-world expertise. We are seeking dedicated, motivated Security Officers to join our team and help us protect our clients' assets and ensure the safety of their personnel.Responsibilities:Patrol and monitor assigned posts to prevent and detect security breaches.Enforce client-specific rules and regulations, as well as company policies and procedures.Conduct regular checks of assigned areas to ensure safety and security.Respond to alarms, emergencies, and other security incidents, providing assistance and maintainProTech Fire And Security
Houston, TX • (41.9 miles) • Full Time • 9/15/2026
The Senior Project Manager for Commercial Fire Alarm and Security Installs will oversee medium-sized project teams, typically consisting of 6-15 members, ensuring the successful delivery of installation projects for fire alarm and security systems. Reporting to Senior Management, this role requires frequent travel to job sites to maintain direct oversight and client engagement. The ideal candidate will combine strong project management skills with industry-specific knowledge to coordinate teams, manage budgets, and uphold safety and quality standards.ResponsibilitiesPlan and schedule project activities to ensure timely completionCoordinate and lead project teams to achieve objectivesMaintain effective communication with clients and stakeholdersManage project budgets and control costsEnsureAMSYS Innovative Solutions LLC
Prairie View, TX • (31.6 miles) • Full Time • 9/11/2026
Fortinet Network Security EngineerWe are looking for a hands-on Fortinet expert with strong experience working with Fortinet network security solutions.The primary requirement for this role is deep, practical Fortinet experience. We are looking for someone who has worked extensively with Fortinet technologies and can independently configure, manage, troubleshoot, and support Fortinet environments.What we're looking for:Strong hands-on experience with Fortinet / FortiGateConfiguration, administration, and troubleshooting of Fortinet firewallsExperience with firewall policies, NAT, VPNs, security profiles, and related Fortinet security featuresExperience managing and troubleshooting Fortinet environments in productionFamiliarity with FortiManager and FortiAnalyzer is preferredAbility to indeLocke Protective Services
Houston, TX • (41.9 miles) • Full Time • 9/11/2026
HIRING NOW!!!We are seeking a Security Officers (Commissioned and Non-Commissioned) and Response Officers to become an integral part of our team. The selected individual will patrol and secure assigned premises as well as identify risks to staff and patrons.Qualifications:Must have reliable transportationMust have TX Driver's License & SS CardMust have working phoneMust be at least 21 years of ageMust have a clear criminal backgroundPay Rate: $18.00 Benefits include Weekly Pay, Holiday Pay, Direct Deposit, Company paid uniforms, Paid Vacations, 401K Plan, and Medical and Dental Plans. Officer of the Quarter AwardMust apply in person at: 1616 S. Voss, Houston, TX 77057, Suite #250 Monday-Friday 8:30 am to 3:30 pm.\nCompany DescriptionIn business since 1994, Locke Protective Services is theGuardian Safe & Lock LLC
Tomball, TX • (41.6 miles) • Full Time • 9/10/2026
Security Technician (Locksmith / Access Control / CCTV / Structured Cabling)Guardian Safe & Lock LLC – Houston, TX (Tomball Area)Guardian Safe & Lock LLC is one of the fastest-growing locksmith and security companies in the Houston metropolitan area. We specialize in access control, CCTV, and physical security integration, and we are looking for a motivated Security Technician to grow with us.This is not just a job, this is a long-term career opportunity with a company that is expanding year over year and building a strong, high-performing team.In this role, you will be responsible for installing, maintaining, troubleshooting, and repairing a wide range of security systems and related infrastructure. You will travel to residential, commercial, and industrial job sites performing a varietyNational Collaboration Security, LLC
Houston, TX 77021 • (42.6 miles) • Full Time • 9/7/2026
Benefits/PerksCareer Advancement OpportunitiesCompetitive CompensationFlexible ScheduleJob SummaryWe are seeking a professional Security Guard to join our team. In this role, your primary responsibility will be to create a safe and secure environment. You will protect our premises, assets, and employees and prevent any illegal or inappropriate occurrences. The ideal candidate has experience with public safety and security and operates with a high degree of integrity at all times.ResponsibilitiesPatrol the premises and maintain a high level of visibilityMonitor entrances and exits to ensure only authorized personnel access the facilityRemove trespassers when necessaryMonitor surveillance camerasRespond to reports of suspicious activityReport on daily activities and any security incidentsQuaAll Nation Security Services, Inc.
Houston, TX • (41.9 miles) • Full Time • 9/5/2026
Join Our Security Team!Are you looking for a stable, rewarding job with growth opportunities? We’re hiring dedicated security professionals! Here’s what we offer:What We Offer:- Set schedules available – Day, swing, and overnight shifts based upon availability.- 90-Day Raise and Performance Bonuses– Start building your career and earning more, fast.- Growth Opportunities– We promote from within for those ready to take the next step!Requirements:- Must Pass a Drug Test – This is a non-negotiable requirement.- Experience & Knowledge – Prior security experience is a plus, but we’re willing to train the right candidates.- Credentials – You must possess:- A valid Texas ID or Driver’s License.- A valid Social Security Card.- A current Non-Commission Security Guard License (Certificates are not aVirtuo Group Corporation
Houston, TX • (41.9 miles) • Full Time • 9/2/2026
Are you passionate about protecting organizations from cyber threats and helping shape the future of cybersecurity? Virtuo Group is seeking a skilled and motivated Cybersecurity Analyst to join our award-winning team. In this role, you’ll monitor, detect, and respond to security incidents, while working alongside experts who are dedicated to keeping our clients’ systems secure. If you thrive in a fast-paced, dynamic environment and enjoy solving complex challenges, this is the opportunity to make a real impact.Workdays & Hours: MONDAY – FRIDAY 8:00 AM – 5:00 PM* *Subject to Change / Remote is Not an OptionDESCRIPTION OF DUTIES / ESSENTIAL FUNCTIONSDuties, functions and responsibilities of this position include:Responsible for communicating cyber risks and recommendations to mitigate risksIn Service Security LLC
Houston, TX • (41.9 miles) • Full Time • 8/21/2026
We are seeking a Commissioned Security Officerto become an integral part of our team. The selected individual will patrol and secure assigned premisesas well as identify risks to staff and patrons.Responsibilities:Monitor premises to prevent theft, violence, or infractions of rulesThoroughly examinedoors, windows, and gates to ensure proper function and securityWarnviolators of premise rules and regulationsApprehendor expelpersons engaging in suspicious or criminal actsReport anyfacility issues such as fire hazardsRequest emergency personnel for high risk situationsQualifications:Previous experience in security, law enforcement,or other related fieldsFamiliarity with security equipmentAbility to handle physical workloadStrong attention to detail\nCompany DescriptionIn Service Security LLCCLantern Village Apartments
Sugar Land, TX • (25.9 miles) • Full Time • 8/19/2026
One of the largest residential apartment communities in Southwest Houston is seeking a dependable, observant, and customer-service-oriented Unarmed Security Officer. In this role, you will maintain a safe, welcoming environment for residents and guests through active foot patrols, visitor logging, and clear daily communication.Key Responsibilities:Access Control & Visitor Logging: Greet residents and visitors, verify credentials, and maintain accurate visitor and vehicle logs at access points.Property Patrols: Perform routine, thorough foot patrols across property grounds, parking areas, and common amenities to deter unauthorized activity.Documentation & Reporting: Maintain detailed shift logs and draft clear, professional incident reports or daily correspondence.Resident Assistance & ServWaveStrong, Inc.
Houston, TX • (41.9 miles) • Full Time • 9/12/2026
Exciting Security / Soc Analyst III, 6 months contract opportunity in Houston, TX.Requirements5 plus years experience in the security domain, Incident Response, threat monitoring, and handling incidents (incident triage and response)Determine detection requirements for data sources being on-boarded to the SIEM, and assessing the value of in place SIEM detection cases, in order to determine gaps and overlap in the overall detection scheme.Perform security monitoring and incident response of cyber security events for proper determination of being considered a cybersecurity event.Triage offenses for false positivesHands-on experience defining detection or protection schemes based on industry standards and frameworks.SIEM, Endpoint Detection and Response, Firewall/IPS/IDS, Proxy, Data Loss PreFIRST SERVICE CREDIT UNION
Houston, TX • (41.9 miles) • Full Time • 9/11/2026
Role:As a Cybersecurity Analyst, you will protect the Credit Union's information assets, systems, and member data through proactive monitoring, risk management, incident response, security governance, and continuous improvement activities. The position supports cybersecurity operations, regulatory compliance, vendor risk management, and cyber resilience initiatives aligned with NIST Cybersecurity Framework (CSF), CIS Controls, FFIEC guidance, and NCUA expectations. The Cybersecurity Analyst partners with technology and business teams to integrate security into all business processes and technology solutionsEssential Functions & Responsibilities:Monitor and investigate security events, alerts, and anomalous activity. Analyze threats using SIEM, EDR, NGAV, and threat intelligence sources. PaPure IT CUSO
Tomball, TX 77375 • (42.7 miles) • Full Time • 9/11/2026
About Us We’re a growing Managed Services Provider (MSP) dedicated to supporting credit unions with their IT and cybersecurity needs. Our mission is simple: keep our clients’ technology secure, reliable, and running smoothly so they can focus on serving their members. We value teamwork, curiosity, and innovation, and we believe that doing great work should also be fun. If you’re eager to build your cybersecurity career in a supportive, fast-growing environment, you’ll feel right at home here.The Position: The Security Analyst is an entry-level cybersecurity professional responsible for monitoring, analyzing, and supporting our client's organization’s security. This role focuses on operational security and works closely with outsourced Security Operations Centers (SOCs), internal InformatioPegasus Preserve Of Memorial City
Houston, TX 77024 • (34.7 miles) • Full Time • 9/10/2026
Do you have a passion to serve Seniors? More importantly, do you want to know that every day you are making a difference in a resident’s life in a senior living building? Then come join our team Human Resources Director!Great Place to Work Certified – come make it greater!! So many perks and programs!!Lead Security Guard/Partner Perks, Programs, and Benefits:Flexible Scheduling – In most cases, we can work our schedules to fit your schedule! (FT/PT)Same-Day pay options available (FT/PT)Competitive Benefits! Some highlights include: Medical (FT), Dental (FT), Vision (FT), 401K including matching (FT/PT), Employee Assistance (FT/PT) and much more!Up to 20 days per year of PTO (FT)Access to various Travel, Restaurant, and Retail Discounts through HR Partners (FT/PT)Unlimited employee referralTRI SHIELD SECURITY & INVESTIGATIONS LLC
Houston, TX • (41.9 miles) • Full Time • 9/10/2026
SECURITY OFFICERS - NON AND COMMISSIONEDTri Shield Security & Investigations Currently has an opening for a Full time Commission Security Officers to serve in the Houston area and must have level lll card in hand.*******************************************************************************************************We are seeking Experienced Security Officers with a positive attitude, customer service experience, great work ethics, and those who can work alone as well as with others. The ideal Security Officer is safety focused, an effective communicator, detail oriented, and ready to serve and protect the public and our clients.Position Details:(Full-time Level 3 Commissioned)Candidates with Criminal Justice, military, police, and Commissioned security experience are encouraged to apply.SEAbsolutesf LLC- Absolute Security Force LLC
Houston, TX 77003 • (43.9 miles) • Full Time • 9/10/2026
Benefits/PerksCareer Advancement OpportunitiesCompetitive CompensationFlexible ScheduleJob Summary We are seeking a professional Security Guard to join our team. In this role, your primary responsibility will be to create a safe and secure environment. You will protect our premises, assets, and employees and prevent any illegal or inappropriate occurrences. The ideal candidate has experience with public safety and security and operates with a high degree of integrity at all times. ResponsibilitiesPatrol the premises and maintain a high level of visibilityMonitor entrances and exits to ensure only authorized personnel access the facilityRemove trespassers when necessaryMonitor surveillance camerasRespond to reports of suspicious activityReport on daily activities and any security incidentsQGoldfish Swim School - Houston Heights
Houston, TX 77008 • (40.5 miles) • Full Time • 9/10/2026
Benefits:Free uniformsOpportunity for advancementTraining & developmentFlexible scheduleSaving and changing lives, every single day. We have a mission to teach kids how to swim and be safer, in and around the water, while making their experience GOLDEN! Working for Goldfish Swim School will allow you to provide children and families with necessary life skills to combat the ever-growing drowning statistics. Whether you are in the pool leading instruction for our swimmers or warmly greeting our members in our tropical lobby as a front desk representative, you are making an impact. Perks and Benefits:Paid on-the-job trainingFlexible schedulingCulture driven companyEmployee recognition programsPrimary Responsibilities:Keep swimmers safe with lifeguard supervisionProvide any first aid necessaryUnited Service Company
Houston, TX 77002 • (42.8 miles) • Full Time • 9/9/2026
Hotel Security Officer-FT United Security Services, Inc., a national security company, is seeking a professional full-time overnight Security Officer for an upscale hotel in the Downtown Houston area.Security Officer Position Requirements:At least 2 years of public safety or private security experience.Have excellent customer service skills and sound judgement.Schedule adherence and punctuality.Must be proficient with interacting, communicating and working jointly with a hotel staff.Must possess, or can acquire by time of employment, a Level II noncommissioned Texas Security Officer license.Must have the availability and flexible to work any day, including weekends and holidays, and any work shift based on the operational needs of the hotel.Must be able to climb stairs, stand, walk for lonThompson Safety, LLC
Houston, TX 77066 • (40.5 miles) • Full Time • 9/9/2026
Job Summary:The Fire Alarm Technicianis responsible forthe installation, testing, inspection, service, and repair of fire alarm systems. Respond to emergency and maintenance calls and troubleshoot/replace faulty devices to restore alarm panels to “normal condition”.Complete inspection and service reports.Supervisory Responsibilities:NoneEssential Job Functions:Traveltocustomerlocationstoperforminstallation,service,andupgradesoffirealarmsystems.Respondtoemergencysituationsduringandafterbusinesshourstoresolvesafetyconcerns.PerformAnnualandSemi-annualinspectionofLifeSafetySystems.Write and provide inspection/service reports on tested equipment and devices.Indicate any deficiencies or corrections that need tobemade.TroubleshootanddiagnosefaultsormalfunctionsinfirealarmsystemsandtakeappropriateDigi Security Systems
Houston, TX • (41.9 miles) • Full Time • 9/9/2026
Digi Security Systems is an industry leader in the design, installation and support of custom video surveillance, electronic access control, and intrusion detection solutions for public and private partners. We've built our reputation on innovation and reliable service, and we're known as the industry's experts.Position OverviewDigi Security Systems is seeking an experienced low voltage Project Manager to oversee the planning and execution of high-level commercial security systems projects. A PMP certification (or equivalent project management certification) required.This role involves managing teams responsible for installation, service, troubleshooting, and programming of systems including video surveillance, electronic access control, and intrusion detection. Preference will be given toPower Plus
Houston, TX 77041 • (33 miles) • Full Time • 9/8/2026
Are you a lead-generating, prospecting, relationship-building, sales machine? Do you love the challenge of discovering potential clients, reaching out to them, and maintaining relationships? If so, we should talk.We arePower Plus!A multi-industry leader in providing power when you need it, where you need it through intelligent and efficient power solutions. We work with Fortune 100 companies across the country such as Amazon, Wal-Mart, Costco, and more. We’ve built a more than 35-year reputation for excellence through our commitment to developing our people, providing exceptional, relationship-based customer service, and giving back to the community. Our biggest differentiator is the quality of our people, and the working environment we create for them, which really has to be seen to be beEnchanted Rock Management LLC
Houston, TX 77002 • (42.8 miles) • Full Time • 9/8/2026
Description: We are ERock!ERock is a leader and innovator in distributed energy. ERock has responded to long-term trends in electricity by becoming the first smart-grid supplier to US energy consumers. The company installs, operates, and integrates its highly flexible, low-cost, and quick-response distributed generation to increase reliability and stability, reduce costs and decrease carbon footprint.At ERock, our backup generators ensure that customers will never be without power, allowing their business to operate normally when there is an outage in the area. Our innovative approach provides customers with highly reliable, ultra-clean backup generation at a fraction of the cost of traditional backup solutions. We seek those who share our commitment to customer service, innovation, and inContinuity Global Solutions
Katy, TX • (17.6 miles) • Full Time • 9/6/2026
Location:Overseas, Camp Bondsteel Pristina, KosovoBenefits:First-Year Completion BonusTravel AllowanceAnnual PTO Allowance Continuity Global Solutions CGS - Kosovo, LLC (CGS - Kosovo) is advertising in your community for an exciting opportunity to work overseas on a U.S. Government contract in the Eastern European Country of Kosovo -in the city of Pristina.Whether you are just looking for a job in an exciting location with opportunities for growth or simply want to get your foot in the door in Government contracting where we could help you gain or maintain a security clearance – this opportunity is for you!Summary:The Armed Security Guard provides security, installation access control, roving patrols, surveillance, monitoring and overall safeguarding to the installation and its tenants. ThGreen City Security
Sugar Land, TX 77478 • (27.4 miles) • Full Time • 9/5/2026
Here we grow again!Position: Unarmed Flex Security Officer (Floater)This position is based in Houston, TX. We are looking for security officers who already have a full time job and want to work here on their days off/off season.How it works: We ask you your availability and schedule to any open posts that we have available. Once confirmed, we will assign you to a site. Dependability is a must to keep this position within Green City Security. We are OK with you not being available all the time, but once you confirm you are available, we do expect you to come through!The pay for this position $16.00 per hour with part-time to full-time hours. You must have a working vehicle in good condition to work at this post.Responsibilities:Foot patrol premises regularly to maintain order and establishSwimJim Texas
Houston, TX 77042 • (31.2 miles) • Full Time • 9/5/2026
SwimJim Texas is a year-round, indoor, heated facility looking to interview future SwimJim super hero lifeguards and swim coaches! We are looking for individuals who can add to our already fun and dynamic team. We are a team consisting of individuals who genuinely enjoy working with one another and have great work ethic and believe in making every day, a positive one!Our mission is to help prevent drowning in a Happier, Healthier and Safer method.We are looking for excited individuals who understand the importance of water safety and keeping swimmers safe. We are looking for individuals who take pride in their duties and responsibilities as lifeguards and swim instructors. All swim instructor training is done in-house. Give us the opportunity to train you with the tools necessary to becomeQuanex
Houston, TX 77024 • (34.7 miles) • Full Time • 9/5/2026
Quanex is looking for aCybersecurity Manager in Houston, TX or Akron, OH.The Cybersecurity Manager will be responsible for oversight, monitoring, and alerting all aspects of the Quanex cybersecurity environment. This position will have direct reports and will be responsible for the cybersecurity program of the business.We Offer You!Competitive Salary401K Match w/ 2-year vesting periodBonus PotentialMedical, Dental & Vision PlansPaid Time Off & HolidaysVarious Work SchedulesTuition AssistanceWellness/Fitness ResourcesTraining/DevelopmentEmployee Stock Purchase PlanDynamic Culture & People - just to name a few!What’s attractive about the Cybersecurity Manager position?Lead and strengthen Quanex’s enterprise cybersecurity program, helping protect critical systems, data, and global operations.Charlie Mike Protective Services
Houston, TX 77056 • (36.7 miles) • Full Time • 9/4/2026
Unarmed Security Officer$25/hour | Childress, TX | Housing, Transportation & Meals Provided | W-2 Employment | Growth Into Armed & Executive Protection | Full-Time OpportunitiesThis position is assigned toChildress, Texas. Transportation, lodging, and meals are provided. Team members may stay on-site for extended periods depending on project schedules. Candidates from Dallas, Amarillo, and surrounding areas are encouraged to apply.You represent the client, the company, and the standard every time you step on site.You stay alert, communicate professionally, handle pressure without losing composure, and take ownership without needing someone to constantly manage you.This is not a “sit around and collect a check” security position.At* Charlie Mike Protection,* we are building a team of dependJ Holdings
Katy, TX 77494 • (16.5 miles) • Full Time • 9/4/2026
NON-COMMISSIONED Level 2 Security Guard Some alternating exterior foot patrols at some locations. Some locations require scans as part of the patrol.- Must be professional in appearance, skillset, and attitude. - Must be at least 21 years of age. - Must have reliable and dependable transportation. - Must have a smartphone. - MUST BE ABLE TO START IMMEDIATELY!!!Security Guard Services
Houston, TX 77077 • (26.7 miles) • Full Time • 9/4/2026
Armed officer Hiring:Best to email Resume, Guard Card and Availability to: Responsibilities and Duties: Security officer tasks may include but not limited to:Securing premises and personnel by patrolling property; monitoring surveillance equipment; inspecting buildings, equipment, and access points; permitting entry. Obtains help by sounding alarms. Prevents losses and damage by reporting irregularities; informing violators of policy and procedures; restraining trespassers, identifying risks and notifying appropriate management authority or 911/Police. Completes reports by recording observations, information, occurrences, and surveillance activities. Maintain a written log of all daily activities per shift.Solaris Oilfield Infrastructure, LLC
Houston, TX 77024 • (34.7 miles) • Full Time • 9/4/2026
Company Description About Solaris Energy Infrastructure Solaris Energy Infrastructure, Inc. (NYSE:SEI) provides scalable equipment-based solutions for use in distributed power generation as well as the management of raw materials used in the completion of oil and natural gas wells. Headquartered in Houston, Texas, Solaris serves multiple U.S. end markets, including energy, data centers, and other commercial and industrial sectors.Job Description About the OpportunitySolaris is building out networked power generation and distribution assets across multiple customer sites. Site networks reach down to turbine and balance-of-plant equipment, SCADA runs on Ignition, and protection and control includes SEL devices connected over SEL software-defined networking.This environment is being designedMetroNational
Houston, TX 77024 • (34.7 miles) • Full Time • 9/4/2026
Description:MUST be able to WORK Weekends / $18.60hr / MUST have valid TDLEverything we do at MetroNational comes back to our purpose: To Build Better Lives. It’s our North Star and the reason we do the work we do. As a MetroNational Bike Patrol Officer, you build better lives by forming bonds with our guests, tenants, and residents, developing relationships with them, and ensuring a safe environment on our beautiful campus in Memorial City.The Security Ambassador III - Bike Patrol, is responsible for securing designated areas in and around Memorial City Mall, conducting bike patrols. We believe in providing exceptional service every day and ask that you go above and beyond to make service a priority in your safety role. This position does require some scheduling flexibility as we provideS.A.F.E. MANAGEMENT
Houston, TX 77054 • (39.8 miles) • Full Time • 9/4/2026
Now Hiring Event Staff at NRG Park!Company DescriptionS.A.F.E. (Security, Athletic Facilities & Events) Management is specifically tailored guest services, security, crowd management and parking staffing company that specializes in sport facility, special event management and 24/7 facility security.Description:S.A.F.E. Management is currently hiring! Are you looking for a part-time job where you can make your own schedule? Do you thrive working in a fast-paced exciting atmosphere and enjoy sporting events and concerts? S.A.F.E. Management is currently hiring part-time Event Staff Team Members to work at - NRG Park in Houston, TX!Summary ? Part-Time Event StaffS.A.F.E. Management's team members enjoy working sporting events, concerts, and other events. We strive to be friendly & considerateTier One Holdings, LLC
Houston, TX • (41.9 miles) • Full Time • 9/4/2026
Armed Security Officer Houston, TX (North Cypress Area)Protect. Mentor. Lead.Serve with Purpose.Houston, TexasAt Tier One, we believe every person deserves to feel safe where they work, receive medical care, worship, or do business. As an Armed Security Officer, you'll be more than a uniform the calm professional who brings confidence during uncertainty, the trusted presence people rely on, and the first line of defense when safety matters most.If you've worn a badge, served in the military, worked in security, or simply feel called to protect others, you already understand that real security is about earning trust not just carrying a firearm.About the AssignmentThis position supports a healthcare and community-safety environment at a major medical campus in the Houston area. Officers assiHM Alpha Hotels & Resorts
Houston, TX 77002 • (42.8 miles) • Full Time • 9/4/2026
The Loss Prevention Manager is responsible for overseeing the hotel’s loss prevention and security programs, including the prevention of theft, fraud, and vandalism. This position ensures the safety of guests, staff, and hotel property by implementing and enforcing security policies and procedures, investigating incidents, and working with local law enforcement as necessary.HOW YOU’LL SHAPE THE EXPERIENCE & FUTUREOversee day-to-day security operations, ensuring the safety and security of hotel guests, staff, and property.Investigate incidents of theft, fraud, or other illegal activities, compiling reports and working with law enforcement as required.Use and monitor surveillance systems, including CCTV cameras, alarms, and other security equipment to detect and respond to suspicious activitAllied Universal
Brookshire, TX 77423 • (14.8 miles) • Full Time • 9/3/2026
Overview Allied Universal®, North America’s leading security and facility services company, offers rewarding careers that provide you a sense of purpose. While working in a dynamic, welcoming, and collaborative workplace, you will be part of a team that contributes to a culture that positively impacts the communities and customers we serve. Job Description As a Armed Security Officer - Empire Blvdin Brookshire, TX, you will serve and safeguard clients in a range of industries such as Retail/Malls, and more. Join a leading team where flexibility meets opportunity. As a Part-Time Security Officer, you can build a schedule that works for you and explore new roles using our Claim a Shift platform. Learn more: aus.com/earnmore. As an Armed Security Professional at a retail location, you will coFoxconn Industrial Internet - FII
Houston, TX 77064 • (37 miles) • Full Time • 9/3/2026
Security Control Room Coordinator (IB3) Location: Houston, TX 77064 Business Unit:CESBG Job Classification: None- Exempt SUMMAR Operation and supervision of technical equipment incontrol room in order to monitor persons, assets, and ongoing processes within the plant area, and to respond immediately to extraordinary events and emergency signals.Preparing daily reports on the operation and condition of the technical equipment managed, as well as on events occurring during the shift KEY RESPONSIBILITIESAlarm response: Operate installed technical devices, monitor signals, and prepare reports on triggering events. All relevant data must be documented (e.g., alarm, acknowledgment, intervention initiated, persons involved, detailed documentation of actions taken).Continuously monitor CCTV imagesAdvanced Sentry LLC
Houston, TX 77002 • (42.8 miles) • Full Time • 9/2/2026
Description: Mobile Security Officer (Flexible / Part-Time)JOB DESCRIPTIONAdvanced Sentry LLC is seeking professional and dependable individuals for flexible mobile security assignments across Texas. This role is designed for individuals who are comfortable working independently and accepting assignments based on their availability.WHAT YOU’LL DOPerform mobile security assignments at client locationsMaintain a visible and professional presenceObserve, document, and report incidents or unusual activityProvide professional customer service when interacting with residents, staff, or clientsCommunicate clearly with dispatch and team membersWORK STRUCTUREThis is a flexible, part-time role with no guaranteed hoursYou are not required to accept assignmentsAssignments are offered as they become avCity Of Brenham, TX
Brenham, TX 77833 • (44.9 miles) • Full Time • 9/2/2026
Part Time Lifeguard Positions Available Monday-Friday 5:30am-1:30pmFlexible SchedulesStarting Pay is $11.00 per hourEssential Duties and Responsibilities include the following. Other duties may be assigned as needed.Good Guest RelationsEnsuring patron safety by strictly enforcing all pool rules and regulations and applying disciplinary action for violationsEffectively maintains 10/20 ruleHave thorough knowledge of skills to rescue guest and administer appropriate techniques to assist guest in need of care as situation deems necessaryCarries out emergency operation procedures and notifies proper authoritiesAssists in maintaining facilitiesReports to Head Lifeguard/Aquatics Superintendent those guests who continue to break policies and cause disciplinary and safety problemsWears the proper uWILSON FIRE EQUIPMENT & SERVICE CO INC
Houston, TX 77040 • (36.3 miles) • Full Time • 9/2/2026
Description: Fire Alarm TechnicianWe are seeking a dedicated and detail-oriented Fire Alarm Technician to join our safety and security team. In this role, you will be responsible for installing, inspecting, maintaining, and repairing fire alarm systems to ensure compliance with safety standards and regulations. Your expertise will help protect lives and property by ensuring our fire alarm systems operate reliably and effectively.Key Responsibilities:- Install, test, and commission fire alarm systems in new and existing buildings- Conduct routine inspections and preventive maintenance on fire alarm equipment- Diagnose and repair faults or malfunctions in fire alarm systems- Ensure all fire alarm systems comply with local codes, standards, and safety regulations- Maintain detailed records ofManhattanLife Insurance & Annuity Company
Houston, TX 77092 • (37.9 miles) • Full Time • 9/2/2026
Who we are: ManhattanLife Insurance and Annuity Company was founded in 1850, the Company’s longevity makes it one of the oldest and most reliable health and life insurance companies in the country. Operating successfully for over 175 years is a testimony to ManhattanLife’s enduring history, and an indicator of the reliability of our future. ManhattanLife’s headquarters are in Houston, TX and the company is continually growing with multiple office locations nation-wide. ManhattanLife offers attractive employee benefits starting day one, including immediate coverage under our health, dental and vision plans. We offer flexible schedules, including shortened hours on Fridays, free parking, company-wide events, professional development, and a company-wide wellness program. Scope and Purpose:We