Houston, TX 77043 • (25.3 miles) • Full Time • 9/28/2026

Description: Job SummaryThe Night Auditor is responsible for the preparation and disposition of all Night Audit work. Responsible for the front desk operation during the overnight shift (Typically 11pm-7am). Primary responsibilities include: registering guests, making reservations, preparing daily reports, balancing transactions, and conducting security walks.Education & ExperienceAt least 1 year of progressive experience in a hotel or a related field required.High School diploma or equivalent required.College course work in related field helpful.Previous supervisory responsibility preferred.Must be able to work independently and with minimal supervision.Knowledge of Accounting Principles.Must be able to problem solve and troubleshoot in order to resolve guest issues that may arise and res

Houston, TX • (35.8 miles) • Full Time • 9/28/2026

We are looking for an experienced Low Voltage Technician to join the team at Nexus Technology and Security, a small business based in Houston, TX. The company operates in several states, including Louisiana, Texas, Oklahoma and Arkansas. This role involves installation, maintenance and service of Access Control, CCTV and Intrusion Detection systems in commercial, industrial, and enterprise environments. The ideal candidate’s home base is Houston, TX or Dallas, TX.To be successful in this role, you need:Three to four years of experience with electronic security systems (access control, CCTV, and intrusion detection)Low voltage wiring experienceAbility to troubleshoot programming challenges and follow system instruction manualsExperience with systems such as Lenel, Genetec, Salto, and Avigil

Houston, TX 77057 • (29.3 miles) • Full Time • 9/28/2026

Description: Houston Country Club (HCC) is seeking friendly and experienced American Red Cross Certified Lifeguards for our outdoor pool that will be open from April - October, with additional employment opportunities throughout the year. HCC operates a supportive work environment with full-time and part-time hours, provides meals, work incentives and bonuses, uniform and certification assistance.Duties and ResponsibilitiesMust have a Happy, Positive, Energetic, Outgoing, Passionate, Helpful, and Fun-Loving AttitudeImplement and execute pool safety in and around the poolAttend Mandatory Weekly In-servicesAssist Opening and Closing ProceduresAssist swimming instructors, swim team, pool members, pool parties, and other activities.Adheres to all pool safety standards, including safety procedu

Houston, TX • (35.8 miles) • Full Time • 9/27/2026

ResponsibilitiesDevelop plans to safeguard computer files against unauthorized modification, destruction, or disclosure.Choose, implement, monitor, and upgrade computer anti-virus and malware protection systems.Encrypt data transmissions and erect firewalls to conceal confidential information during transmission.Implement password authentication to keep unauthorized users from accessing sensitive data files.Modify security files to incorporate new software, correct errors, and change user access status.Perform risk assessments and tests on running data processing activities and security measures.Educate workers about computer security and promote security awareness and security protocols.Keep accurate and current backup files of all important data on the shared corporate network.IT securit

Houston, TX 77064 • (30.6 miles) • Full Time • 9/27/2026

Senior Security Design Engineer Job Description A Senior Security Design Engineer will design, implement, and maintain systems that protect facilities, assets, and personnel, such as card access control, surveillance (CCTV), and intrusion detection. The role will create technical drawings, site layouts, and construction specifications for security systems, utilizing tools like CAD and REVIT. This role will be responsible for providing sales, operational and client support in the design, installation, and commissioning of low voltage security systems and other related systems and software as required. The primary responsibilities will be fully engineering a security system and providing design documentation in CAD/REVIT formats, procurement (BOM) outlines, security device installation detai

Brookshire, TX 77423 • (11 miles) • Full Time • 9/27/2026

Overview Allied Universal®, North America’s leading security and facility services company, offers rewarding careers that provide you a sense of purpose. While working in a dynamic, welcoming, and collaborative workplace, you will be part of a team that contributes to a culture that positively impacts the communities and customers we serve. Job Description Life doesn’t always follow a fixed schedule. That’s why we created the Security Officer – Part Time Enhanced position: a flexible, dependable option for individuals looking to supplement their income, gain hands-on experience, or work toward a full-time career with the industry leader.As a Security Officer Enhanced Part Time Armed Patrol Response Driver in Brookshire, TX, this role is designed to provide reliable, consistent hours at an

Houston, TX 77079 • (23.1 miles) • Full Time • 9/26/2026

Benefits:Competitive salaryFree uniformsBenefits/PerksCareer Advancement OpportunitiesCompetitive CompensationFlexible ScheduleJob Summary We are seeking a professional Security Officer to join our team. In this role, your primary responsibility will be to create a safe and secure environment. You will protect our premises, assets, and employees and prevent any illegal or inappropriate occurrences. The ideal candidate has experience with public safety and security and operates with a high degree of integrity at all times. ResponsibilitiesPatrol the premises and maintain a high level of visibilityMonitor entrances and exits to ensure only authorized personnel access the facilityRemove trespassers when necessaryMonitor surveillance camerasRespond to reports of suspicious activityReport on da

Houston, TX 77063 • (27.3 miles) • Full Time • 9/26/2026

As a Barron’s Top 100 RIA firm and voted Best Places to Work by Fortune, Pacific Coast Business Times, Inc. (Best Workplaces), and Investment News, Mission Wealth is hiring a growth-minded Cybersecurity Specialist to join our award-winning team! If you are ready to elevate your career in a leading wealth management company with a commitment to giving back to the community and expanding nationally, let’s go!Our ideal candidate is a hands-on cybersecurity professional who hustles and has experience supporting security operations and technical controls in a regulated environment. You are curious, organized, and comfortable digging into alerts, logs, and technical issues. You also understand that cybersecurity requires documentation, follow-through, and collaboration across internal teams and

Houston, TX • (35.8 miles) • Full Time • 9/26/2026

Med Security is seeking disciplined and proactive Armed Security Supervisors to serve as the operational anchor for our Houston territory. This position is the primary "bridge" between morning and evening shifts and serves as the second-in-command to the Account Manager. The successful candidates will manage field personnel and will assist the Account Manager during their scheduled shifts in handling high-level client needs, emergency staffing decisions, and administrative oversight.Shift Availability (Position requires a clean driving record and a valid Drivers License):Sat and Sunday(Weekend) from 12pm - 8pmMonday through Friday from 12pm to 8pmMonday through Friday from 4pm to midnightKey Responsibilities:Executive Support: Act as the designated representative for the Account Manager in

Houston, TX • (35.8 miles) • Full Time • 9/26/2026

Join Our Security Team!Are you looking for a stable, rewarding job with growth opportunities? We’re hiring dedicated security professionals! Here’s what we offer:Please submit your resume and candidates can be contacted upon interview availability.What We Offer:- Set Schedules.- All Shifts – Day, swing, and overnight shifts based upon availability.- 90-Day Raise and Performance Bonuses– Start building your career and earning more, fast.- Growth Opportunities– We promote from within for those ready to take the next step!Requirements:- Must Pass a Drug Test – This is a non-negotiable requirement.- Experience & Knowledge – Prior security experience is a plus, but we’re willing to train the right candidates.- Credentials – You must possess:- A valid Texas ID or Driver’s License.- A valid Socia

Pearland, TX 77581 • (42.3 miles) • Full Time • 9/26/2026

ALARM INSTALLATION- CONSTRUCTION TECHNICIANJOB DESCRIPTIONJob Responsibilities include but are not limited to:Installation of fire alarm systems in residential, commercial, and industrial buildingsInstallation, service, and trouble-shooting of fire alarm systems along with all its related equipmentBe a leader: oversee, direct, and delegate appropriate tasks to fulfill project completion deadlines, meet scheduling requirements, and exceed the goals established by the fire alarm managerEnsure project results are achieved within financial and productivity budgetsAccurately complete, execute and process paperwork/electronic or paperless required by the office and corporate management systemsConduct/coordinate necessary testing of the system Ensure required certifications are completeInstruct a

Houston, TX • (35.8 miles) • Full Time • 9/25/2026

Long View. A career that helps you get more out of life. A Long View career helps you get more out of life. We don’t just say it, we prove it. Every day. We’re proud of our reputation as one of North America’s most dynamic IT providers and we’re even prouder of our culture that allows our people to live life to its fullest. At Long View, we create an environment of collaboration and support, of innovation and enthusiasm, of inclusion and belonging. As a member of the Long View team, you’ll see how our company’s core pillars Integrity, Competence, Value, and Fun resonate through the workplace. And in a recent survey, 89% of Long View team members rated Long View as a good or great place to work! Are you a Security professional who excels at designing enterprise-grade security solutions and

Houston, TX • (35.8 miles) • Full Time • 9/25/2026

This role may be based in New York City, Washington DC, Chicago, Houston, the San Francisco Bay Area, or Los Angeles.Control Risks is seeking a Physical Security Designer to support the growth of its Built Environment & Infrastructure design practice in North America.The role will prepare and review design drawings, technical documentation, specifications, schedules, reports, and related files for electronic and non-electronic physical protection systems. This includes support to facility upgrades, new construction projects, and multidisciplinary design and delivery processes.The successful candidate will bring practical knowledge of security design, construction documentation, building and life safety codes, industry standards, and related guidelines, working as part of the US-based Ameri

Houston, TX 77040 • (29.9 miles) • Full Time • 9/25/2026

Benefits:Bonus based on performanceDental insuranceHealth insuranceOpportunity for advancementPaid time offTraining & developmentVision insuranceTechnician – Network Datacom SolutionsLocation: Houston, TX Employment Type: Full-Time Pay: Based on experience About Network Datacom Solutions Network Datacom Solutions (NDS) is a leading provider of integrated technology infrastructure specializing in Audio Visual (A/V), Access Control, CCTV, and Structured Cabling systems. Our team delivers high-quality installations and service for commercial, industrial, and enterprise clients across Texas. Position Overview We are seeking an experienced and motivated Technician with a strong background in low-voltage systems, including Audio Visual, Access Control, CCTV, and Structured Cabling. The ideal can

Houston, TX 77061 • (41.2 miles) • Full Time • 9/25/2026

Senior Cloud Security EngineerAre you passionate about securing modern cloud environments and building enterprise-grade cybersecurity solutions that make a real impact? We’re looking for a highly skilled Senior Cloud Security Engineer to help protect and strengthen our growing technology ecosystem across cloud, hybrid, and on-premise environments.This is an opportunity to join a collaborative IT and cybersecurity team where your expertise will directly influence security strategy, cloud architecture, threat prevention, and operational resilience. If you enjoy solving complex security challenges, improving security posture, and working hands-on with Azure technologies, DevSecOps, IAM, and cloud security tools we want to hear from you.What You’ll DoIn this role, you will design, implement, a

Houston, TX 77006 • (35.1 miles) • Full Time • 9/24/2026

Adjunct Professor in Global CybersecurityThe University of St. Thomas (www.stthom.edu), a private Catholic university located in Houston, Texas, the nation's fourth largest city, committed to the liberal arts and the religious and intellectual tradition of Catholic higher education, invites applications from outstanding candidates for multiple part-time positions of Adjunct Professor of Global Cybersecurity housed in the Department of International Studies & Modern Languages.The Department of International Studies & Modern Languages at the University of St. Thomas is a multidisciplinary program providing quality education to the next generation of global leaders. The Department consists of six full-time faculty and offers four major programs, including International Studies, International

Houston, TX 77004 • (36.5 miles) • Full Time • 9/24/2026

Direct Counsel is seeking a talented Digital Risk Advisory & Cybersecurity Associate with 3–6 years of experience to join a premier, nationally recognized privacy, cybersecurity, and digital risk practice. This is an excellent opportunity for an attorney interested in sophisticated cybersecurity incident response, regulatory investigations, privacy compliance, and proactive cybersecurity advisory work. The successful candidate will advise national and multinational clients on significant cybersecurity matters while receiving meaningful client exposure and substantial responsibility.Locations Atlanta, GAChicago, ILCincinnati, OHColumbus, OHDallas, TXDenver, COHouston, TXLos Angeles, CAOrange County, CAPhiladelphia, PASan Francisco, CASeattle, WAWashington, D.C.Position Overview The associat

Houston, TX • (35.8 miles) • Full Time • 9/22/2026

Firetrol Protection Systems is seeking a highly skilled Fire Alarm and Security Service Technician to join our team. As a full-service fire protection, life safety, and security company, we design, install, repair, service, and inspect a wide variety of fire suppression, life protection, and integrated security systems. As a Service Technician, you will be responsible for maintaining and servicing the fire alarm systems for both new and existing customers. The ideal candidate should be highly organized, detail-oriented, and possess excellent communication skills. We value our team members and offer great benefits, growth opportunities, and a positive work culture.Responsibilities Conduct routine maintenance and repair of fire alarm and security systemsHave knowledge of multiple manufacture

Houston, TX 77093 • (39.9 miles) • Full Time • 9/21/2026

Why Pref-Tech?Voted "Top Workplaces" by Houston Chronicle and USA Today! We aim to make “family” a core reason we attract incredible people, retain them, and collectively deliver unequaled quality and service to customers. If your heart and mind are pushing you to join a team who deeply desires to be the best in the world, has a long-game approach to business, prides itself on doing exceptional work, celebrates service to others, and is willing to invest in you, you should consider Pref-Tech.Position Overview: The Sales Manager will manage and grow a local sales force of Sales Professionals to expand market share within the Houston office, while providing additional sales leadership capacity to support the company's continued growth. This is a newly added position created to support busine

Katy, TX • (11.4 miles) • Full Time • 9/20/2026

Title: Sr. Cyber Security AnalystLocation: Katy, TX- 100% onsiteDuration: Direct HireWork Requirements:US Citizen, GC Holders, or Authorized to Work in the US.SummaryWe are seeking a Senior Cyber Security Analyst to support and strengthen enterprise-wide security initiatives. This individual will be responsible for vulnerability management, threat analysis, cloud security, and incident response while working cross-functionally with IT and business teams. This role is ideal for someone who is hands-on, analytical, and comfortable working across infrastructure, applications, and cloud environments while helping mature the organization's overall security posture.ResponsibilitiesSupport enterprise-wide vulnerability management and remediation effortsPerform advanced threat analysis and risk mo

Houston, TX 77027 • (31.8 miles) • Full Time • 9/20/2026

OverviewOur team is on a mission to create a safe, fun, and encouraging environment where kids not only learn to swimthey thrive! As a Lifeguard, you’ll play a vital role in ensuring every swimmer enjoys a safe and positive experience. You’ll stay alert, protect lives, and help foster a welcoming environment for our students and families.We’ve earned top employer awards nationwide, and it’s all thanks to dedicated team members. Ready to make a splash?Why You'll Love It Here:Make a Real Impact – You’re the first line of safety, ensuring swimmers of all ages can learn and play with confidence.Growth Opportunities – There are more opportunities beyond lifeguarding such as becoming a swim instructor or mentor.Join a Supportive Team – Work alongside fun, motivated teammates who care about safet

Houston, TX • (35.8 miles) • Full Time • 9/20/2026

Lead Fire Alarm & Security InstallerProTech Fire & SecurityHouston, TXFull-Time$22 to $26 per HourJoin a Company Where Your Work MattersAre you an experienced Fire Alarm or Security Installer looking for a company where your skills are valued and your contributions are recognized?At ProTech Fire & Security, we are not a large corporate company where employees get lost in the shuffle. We are a locally owned business that has built our reputation on quality workmanship, strong customer relationships, and taking care of our team.Since 2007, ProTech has provided fire alarm, access control, surveillance, security, voice/data, and low-voltage solutions throughout Texas. We are looking for a Lead Fire Alarm & Security Installer who takes pride in their work, enjoys leading projects, and wants to

Houston, TX 77008 • (34.3 miles) • Full Time • 9/19/2026

Benefits:Lifeguard Certification ClassFlexible scheduleFree uniformsOpportunity for advancementTraining & developmentLooking for a job where you can make a difference while having fun? Are you someone who stays alert, loves being around the water, and wants to help keep others safe? Become a Lifeguard and play an important role in creating a safe, fun, and welcoming environment for every swimmer! Job Title: Lifeguard Reports to: Deck Supervisor Summary: Under general supervision, ensures the safety of patrons of the Goldfish Swim School by preventing and responding to emergencies. 1. Maintains constant surveillance of patrons in the facility; acts immediately and appropriately to secure safety of patrons in the event of an accident or emergency. 2. Communicate the rules of the facility to

Houston, TX • (35.8 miles) • Full Time • 9/19/2026

Role: Cybersecurity / Network EngineerLocation: Houston, TX (Hybrid)Pay Range: $120,000 - $125,000 / yearBenefits: This position is eligible for medical, dental, vision and 401(k)About the RoleWe are seeking a Cybersecurity / Network Engineer to take ownership of a growing enterprise network and help shape the organization's long-term infrastructure and security strategy. This role combines hands-on network engineering with cybersecurity oversight, making it an excellent opportunity for someone who enjoys building secure, scalable environments while proactively identifying opportunities for improvement.The ideal candidate has experience managing enterprise network infrastructure, strengthening security posture, and partnering with third-party security providers to protect business operatio

Houston, TX 77090 • (39.1 miles) • Full Time • 9/19/2026

About the Company: Sungrow North America is a leading provider of renewable energy solutions, specializing in the development and manufacturing of photovoltaic inverters and energy storage systems. The company offers a comprehensive range of products and services designed to optimize the performance and efficiency of solar power installations. Sungrow North America aims to provide sustainable and reliable energy solutions to meet the growing demand for clean power and is known for its commitment to innovation, high-quality standards, and exceptional customer service.Security Engineer – Network & Identity:The Security Engineer (Network & Identity) is a hands-on engineering role within the IT team responsible for designing, implementing, securing, and automating Sungrow USA's network securit

Houston, TX 77086 • (33.3 miles) • Full Time • 9/18/2026

HomePro is seeking a skilled Install Technician in the fields of Security, AV, and Networking to join our vibrant team. If you are someone passionate about technology and customer satisfaction, we would love to hear from you.Role Overview This position involves the installation, maintenance, and troubleshooting of security, audio-visual (AV), and networking systems in residential and commercial spaces to meet clients' high expectations and ensure their satisfaction with our services.Why Join Us? Opportunity to work in a progressive tech environmentFull benefits package including health, dental, and vision insuranceCompetitive salaryPaid time off and company holidays401K with company matchContinuous learning and development opportunitiesTake home company vehicle & gas cardKey Responsibiliti

Houston, TX 77024 • (28.5 miles) • Full Time • 9/18/2026

Description: The Security Manager - Operations works closely with the Security Administrations Manager and supports the Director of Security by leading all daily security related business needs to include Security Ambassador development, patrol operations, incident response and emergency management for Memorial City Mall and other MetroNational properties. The position promotes the safety and well-being of employees, tenants, and guests while ensuring security related policies and procedures are established, updated, and executed. The manager works closely with security ambassadors and provides subject matter expertise while ensuring training and brand service standards are achieved.Essential Duties and Responsibilities:Assist in the overall security program and operations including the tr

The Woodlands, TX • (44 miles) • Full Time • 9/18/2026

FULL-TIME POSITIONS AVAILABLEPriceless Protection Resources LLCTexas Private Security License: C28444101Job DescriptionPriceless Protection Resources LLC is seeking professional, dependable, and service-minded Level III Armed Security Officers for specialized church security assignments.Church security requires a unique balance of vigilance, professionalism, hospitality, sound judgment, and de-escalation. Officers must be able to maintain a strong security presence while interacting respectfully with church members, visitors, staff, volunteers, and ministry leadership.This is not a traditional stand-post position. Candidates must be prepared to actively patrol, monitor activity, support access control, respond to incidents and emergencies, and help maintain a safe and welcoming worship env

Houston, TX 77008 • (34.3 miles) • Full Time • 9/17/2026

Azure Infrastructure & Security AdministratorGet to Know Us: CG Infinity, Inc. is a technology consulting firm that was founded in 1998. We offer solutions that are tailored to the needs of each individual client that we work with instead of offering standard, run-of-the-mill solutions to everyone. We work closely with our clients throughout the entire process and offer solutions for a myriad of challenges. Our Culture: Our people-first approach to technology offers best-in-class service and customer success rates. Here are some of the main services that we offer at CG Infinity: Salesforce Implementations, Customer Experience & CRM, Application Development & Integration, Production Support & QA, and Data Analytics & AI. Position Overview: CG Infinity is seeking a motivated and detail-orien

Houston, TX • (35.8 miles) • Full Time • 9/16/2026

Are you an experienced Alarm Installer/AV Technician looking for a great opportunity? Join a company that values your skills and offers steady, rewarding work! This role focuses oncustomresidentialhomes. Ready to take the next step in your career? Apply today and join a team that values your expertise!Responsibilities:Install access door hardware (some wire pulling involved).Read and interpret plans and blueprints with confidence.Work independently while collaborating with a supportive team.Troubleshoot complex system issues and implement effective solutions.Build strong relationships with customers by providing efficient and reliable service.Conduct site surveys to assess installation requirements.Stay up to date with training and team meetings.Take on additional tasks as needed.Requirem

Houston, TX 77040 • (29.9 miles) • Full Time • 9/15/2026

Description: Objective:Installation Helper to assist in the installation, maintenance, and servicing of fire alarm systems. The ideal candidate will have a basic understanding of electrical systems, excellent attention to detail, and a strong willingness to learn and grow within the field. This role provides hands-on experience in the fire safety industry while working alongside experienced technicians.ResponsibilitiesAssist in the installation and maintenance of low voltage systems.Help troubleshoot and repair low voltage systems and components.Work with the technician to test and inspect low voltage systems for proper operation.Support the setup and wiring of low voltage equipment, including control panels, and devices.Handle tools, equipment, and materials related to low voltage systems

Houston, TX • (35.8 miles) • Full Time • 9/15/2026

Exciting Security / Soc Analyst III, 6 months contract opportunity in Houston, TX.Requirements5 plus years experience in the security domain, Incident Response, threat monitoring, and handling incidents (incident triage and response)Determine detection requirements for data sources being on-boarded to the SIEM, and assessing the value of in place SIEM detection cases, in order to determine gaps and overlap in the overall detection scheme.Perform security monitoring and incident response of cyber security events for proper determination of being considered a cybersecurity event.Triage offenses for false positivesHands-on experience defining detection or protection schemes based on industry standards and frameworks.SIEM, Endpoint Detection and Response, Firewall/IPS/IDS, Proxy, Data Loss Pre

Tomball, TX 77375 • (36.8 miles) • Full Time • 9/15/2026

About Us We’re a growing Managed Services Provider (MSP) dedicated to supporting credit unions with their IT and cybersecurity needs. Our mission is simple: keep our clients’ technology secure, reliable, and running smoothly so they can focus on serving their members. We value teamwork, curiosity, and innovation, and we believe that doing great work should also be fun. If you’re eager to build your cybersecurity career in a supportive, fast-growing environment, you’ll feel right at home here.The Position: The Security Analyst is an entry-level cybersecurity professional responsible for monitoring, analyzing, and supporting our client's organization’s security. This role focuses on operational security and works closely with outsourced Security Operations Centers (SOCs), internal Informatio

Houston, TX 77073 • (41 miles) • Full Time • 9/15/2026

HSSE AdvisorMake An Impact With USThe HSSE Advisor will be a business representative for health, safety, security and environmental (HSSE) programs, ensuring compliance with Vallourec policies and standards, maintaining compliance with ISO Certification standards, and all local, state, and federal regulations. An HSSE Advisor is responsible for promoting a proactive HSSE culture and driving a continuous improvement-based HSSE management system. An HSSE Advisor will collaboration across business departments to align/standardize health, safety, security and environmental programs. An HSSE Advisor is responsible to support development of World Best in Class programs in HSSE Leadership, Management Systems and Culture to deliver on Vallourec’s ambitions for 2030 and beyond.Your Role at a Glance

Houston, TX • (35.8 miles) • Full Time • 9/15/2026

Job Summary: This position is responsible for the installation and activation of monitored security systems through the Company. Is responsible for trouble shooting and repairing these systems when needed. It also helps with other low voltage/AV/network installations of products purchased by the customer.Responsibilities:Basic alarm panel programming.· Basic networking knowledge from router set up, terminating all fittings (Cat 5, Cat 6, R66, BNC, etc.) and inserts.· Speaker installs and volume controls.· Able to find cables or tone cables in walls.· Assists with television hangs.· Able to install WI-FI packages.· Activations for Alarm.com and Total Connect.· Able to install cameras and DVRs.· Knowledge of security panels.· Television hangs without help.· Able to hook up audio/amps.· Proje

Prairie View, TX • (28.3 miles) • Full Time • 9/11/2026

Fortinet Network Security EngineerWe are looking for a hands-on Fortinet expert with strong experience working with Fortinet network security solutions.The primary requirement for this role is deep, practical Fortinet experience. We are looking for someone who has worked extensively with Fortinet technologies and can independently configure, manage, troubleshoot, and support Fortinet environments.What we're looking for:Strong hands-on experience with Fortinet / FortiGateConfiguration, administration, and troubleshooting of Fortinet firewallsExperience with firewall policies, NAT, VPNs, security profiles, and related Fortinet security featuresExperience managing and troubleshooting Fortinet environments in productionFamiliarity with FortiManager and FortiAnalyzer is preferredAbility to inde

Houston, TX 77008 • (34.3 miles) • Full Time • 9/10/2026

Benefits:Free uniformsOpportunity for advancementTraining & developmentFlexible scheduleSaving and changing lives, every single day. We have a mission to teach kids how to swim and be safer, in and around the water, while making their experience GOLDEN! Working for Goldfish Swim School will allow you to provide children and families with necessary life skills to combat the ever-growing drowning statistics. Whether you are in the pool leading instruction for our swimmers or warmly greeting our members in our tropical lobby as a front desk representative, you are making an impact. Perks and Benefits:Paid on-the-job trainingFlexible schedulingCulture driven companyEmployee recognition programsPrimary Responsibilities:Keep swimmers safe with lifeguard supervisionProvide any first aid necessary

Houston, TX 77066 • (34.2 miles) • Full Time • 9/9/2026

Job Summary:The Fire Alarm Technicianis responsible forthe installation, testing, inspection, service, and repair of fire alarm systems. Respond to emergency and maintenance calls and troubleshoot/replace faulty devices to restore alarm panels to “normal condition”.Complete inspection and service reports.Supervisory Responsibilities:NoneEssential Job Functions:Traveltocustomerlocationstoperforminstallation,service,andupgradesoffirealarmsystems.Respondtoemergencysituationsduringandafterbusinesshourstoresolvesafetyconcerns.PerformAnnualandSemi-annualinspectionofLifeSafetySystems.Write and provide inspection/service reports on tested equipment and devices.Indicate any deficiencies or corrections that need tobemade.Troubleshootanddiagnosefaultsormalfunctionsinfirealarmsystemsandtakeappropriate

Houston, TX • (35.8 miles) • Full Time • 9/9/2026

Digi Security Systems is an industry leader in the design, installation and support of custom video surveillance, electronic access control, and intrusion detection solutions for public and private partners. We've built our reputation on innovation and reliable service, and we're known as the industry's experts.Position OverviewDigi Security Systems is seeking an experienced low voltage Project Manager to oversee the planning and execution of high-level commercial security systems projects. A PMP certification (or equivalent project management certification) required.This role involves managing teams responsible for installation, service, troubleshooting, and programming of systems including video surveillance, electronic access control, and intrusion detection. Preference will be given to

Houston, TX 77041 • (26.7 miles) • Full Time • 9/8/2026

Are you a lead-generating, prospecting, relationship-building, sales machine? Do you love the challenge of discovering potential clients, reaching out to them, and maintaining relationships? If so, we should talk.We arePower Plus!A multi-industry leader in providing power when you need it, where you need it through intelligent and efficient power solutions. We work with Fortune 100 companies across the country such as Amazon, Wal-Mart, Costco, and more. We’ve built a more than 35-year reputation for excellence through our commitment to developing our people, providing exceptional, relationship-based customer service, and giving back to the community. Our biggest differentiator is the quality of our people, and the working environment we create for them, which really has to be seen to be be

Houston, TX 77021 • (36.9 miles) • Full Time • 9/8/2026

Benefits:401(k)Employee discountsBenefits/PerksCareer Advancement OpportunitiesCompetitive CompensationFlexible ScheduleJob Summary We are seeking a professional Security Guard to join our team. In this role, your primary responsibility will be to create a safe and secure environment. You will protect our premises, assets, and employees and prevent any illegal or inappropriate occurrences. The ideal candidate has experience with public safety and security and operates with a high degree of integrity at all times. ResponsibilitiesPatrol the premises and maintain a high level of visibilityMonitor entrances and exits to ensure only authorized personnel access the facilityRemove trespassers when necessaryMonitor surveillance camerasRespond to reports of suspicious activityReport on daily activ